SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016535 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016535
Domain Number 1 Region: 464-662
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.3e-70
Family Hemopexin-like domain 0.0000000073
Further Details:      
 
Domain Number 2 Region: 71-213,386-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.94e-36
Family Matrix metalloproteases, catalytic domain 0.000000739
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000554
Further Details:      
 
Domain Number 4 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 1.17e-20
Family Fibronectin type II module 0.0000864
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-19
Family Fibronectin type II module 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016535   Gene: ENSMODG00000013214   Transcript: ENSMODT00000016839
Sequence length 662
Comment pep:novel chromosome:BROADO5:1:445888165:445922153:1 gene:ENSMODG00000013214 transcript:ENSMODT00000016839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTPAAPGVLGFLLPVLWLHSSVFQQTWAAPSPIIKFPGDVSPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPETGELDQSTIETMKKPRCGNPDVANYNFFPRRPKWE
KNQITYRIIGYTPDLDPETVDDAFARAFKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
DKEYNSCTDAGRSDGFLWCATSYNFDSDGKYGFCPHEALFTMGGNAEGQPCKFPFKFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKH
ESCTSAGRSDSKMWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGAL
MAPIYTYTKNFRLSNDDIKGIRELYGSSNDTGTDTGTGPTPTLGPVTPEICTKDIVFDGI
SQIRGEIFFFKDRFMWRMADSREKPTGPLLVATFWPEVPEKIDAVYESPQEEKAVFFSGN
EYWVYSASTLDRGYPKKLTSLGLPPDIQHVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADSWNGIPDNLDAVVELQGSGHSYFFKDWYYLKLENKSLKIVKVGNIKSDWL
KC
Download sequence
Identical sequences F7EVX9
ENSMODP00000016535 XP_001373030.2.35504 ENSMODP00000016535 13616.ENSMODP00000016535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]