SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016547 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016547
Domain Number 1 Region: 563-787
Classification Level Classification E-value
Superfamily GFP-like 1.57e-77
Family Domain G2 of nidogen-1 0.00000119
Further Details:      
 
Domain Number 2 Region: 1152-1408
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-43
Family YWTD domain 0.000000089
Further Details:      
 
Domain Number 3 Region: 1054-1129
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.94e-22
Family Thyroglobulin type-1 domain 0.00089
Further Details:      
 
Domain Number 4 Region: 517-560,798-895
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000115
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 921-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016547
Domain Number - Region: 894-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0127
Family EGF-like domain of nidogen-1 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016547   Gene: ENSMODG00000013225   Transcript: ENSMODT00000016852
Sequence length 1419
Comment pep:novel chromosome:BROADO5:1:280406900:280565520:1 gene:ENSMODG00000013225 transcript:ENSMODT00000016852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRERNTGHQWQLLLLLFHLQWLLPSASALHLQDLFPYGEAWGDQFLQEGDDETSALVKL
KKPLRFYEAQFSSLYVGTNGIISTQQFPREIQYVDNYFPTEFPAIAPFLSDLDTSNGRGK
ISYREDDSIEVLRQAAQYIQTGFPKTAANYTPTHAFLATWKEVRAYEKVIQNVLPSRLVK
LSPILYISFPFCSVSFFFVPYFCLDHPSTPPRQDVRMLSTLPARVASLGKEGERATKSDL
LKYGLSRLQLIVQFFLRISNLGIPGVWAFHIGSIFQLDNVEPANIGGNLSIVHSLEHFLN
NDAEYNVLESNYTEDNMNYVKVFYNEDGDEIEHSPSGQERVSNSNSKTESSLDSNASSPN
QTDHGESKHGIFSPLDSELNFKLLYPAPSHSPISSKIESDSLYPQTEEGTPEREGIFLVS
KGQIKSSQEKGIKSSYPLELLDLLTESPPFYPKNETIRLYPDGGAMSSEMEALSIYSEGV
VLKNYPFPENTPPLNHGRYVMGMEEDSNFKPDVFTYQTSIKETCEQNHRQCSQHAFCTDY
STGFCCHCQSKYYGNGKHCLLKGEPHRVNGKVSGHLHIGHTPVSFNDVDLHAYIVGNDGR
AYIAISHIPHPAAQSLLPLTPIGSLFGWLFALEKPGYVNGFSITGAVFTHHIDITFYPGE
ERVHITHTAEGLDPENYLSVKTNIQGQLPFIPENFTAHIAPYKEIYHYSDLGVTSTTSRE
YFLSLGEMNQTFSYHLHQNISYQDCKNTPNPRIVSRTQQLNVDRIFALYNEDEKVLRYAV
TNNIGPIEGNTDPLVTNPCYDGTHTCDVTAQCLVGTGLAYSCECASGYQGDGRNCFDINE
CVTDSQLCGHNSVCVNLAGSYMCECQNGYEFADDKHTCILISPPSNPCEEGSHTCAPMES
AECIYHGGSSYSCVCLSGYVGNGHECTDIDECIEERCHPTAICHNIPGSFSCHCQPGYNG
DGFQCYLDSPTLSALSSGTKNCYVWRLPQLHWMAMLSFVLQHALSTPQCFAASPSQPLNI
LIGFFHLFGRSSLYMLGKQSPGSPGVDDPMATLTKTTQGPQSICERWRKSLLEHYGGRPR
EDQYVPQCDEFGHFNPLQCHGNSNYCWCVDKDGREVEGTRSQPGFSPACIPSIAPPIILP
SPRPDVIPPSLGTFLLYAQGQQIGYLPLNGTRLQKETAKTLLSLHGSIVVGIDYDCQEKM
VYWTDVAGRVISRAGLELGNEPEIIISSGLMSPEGLAIDYFHRTMFWTDSGLDKIESAKL
DGSERKVLFDNDLVNPRAITVDPIRGNLYWTDWNREGPKIETSSIDGTNRRILVNKDIGL
PNGLTFDPFSKLICWADAGTKKLECASSNGTGRHIIQNNLNYPFSIVSYANHFYHTDWRR
DGVIAINKDNGQFTDEYLPEQRSHLYGITAIYPYCPKGK
Download sequence
Identical sequences F7EDD2
ENSMODP00000016547 13616.ENSMODP00000016547 ENSMODP00000016547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]