SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016601 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016601
Domain Number 1 Region: 354-432
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.1e-24
Family Intermediate filament protein, coiled coil region 0.00097
Further Details:      
 
Domain Number 2 Region: 119-154
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000837
Family Intermediate filament protein, coiled coil region 0.0028
Further Details:      
 
Domain Number 3 Region: 236-350
Classification Level Classification E-value
Superfamily Prefoldin 0.0000628
Family Prefoldin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016601   Gene: ENSMODG00000013275   Transcript: ENSMODT00000016906
Sequence length 498
Comment pep:novel chromosome:BROADO5:2:196685290:196693077:1 gene:ENSMODG00000013275 transcript:ENSMODT00000016906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCLSRISSRAGGSSCARVSGGGSSFSSSSRCGMGGGSARGYGGSSSCGLGGGSGSGFGG
GFGGGFSCGSAVGGYGGGSGSGAGFGGGASGGFYSYGGGAGGGSGYGGFGSGDGGLLSGS
EKQTMQNLNDRLASYLDKVHALEEANTDLEVKIKEWYDKFGPGSRDGGAGKDYSHFFPVI
EDLKNQILHATVENAGIVLQIDNARLAADDFRLKYENELYLRQCVEADTNGLRKVLDDLT
MARSDLEMQIESLTEELAYLKKNHEEEMKNMQSSSGGDVTVEMNAAPGTDLTKLLNDMRA
QYEDLAEQNRREAEEQFNKQSASLQAQISTDAGAASSAKNEITELKRTLQGLEIELQSQM
AMKSSLEGTLADTEADYVAQLSQLQQQISNLEQQICEIRGEMECQNAEYEQLLNIKTRLE
MEIETYRRLLDGEGSGSSSGGSGSWKSGSGSGDSRSGTSSGQGKDSNKTRVTKTIVEEVV
NGKVVSSQVSNVSEVKVK
Download sequence
Identical sequences F7AAB2
XP_007482317.1.35504 ENSMODP00000016601 ENSMODP00000016601 13616.ENSMODP00000016601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]