SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016617 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016617
Domain Number 1 Region: 220-400
Classification Level Classification E-value
Superfamily MIR domain 7.98e-45
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 667-803
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000127
Family SPRY domain 0.072
Further Details:      
 
Domain Number 3 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000902
Family MIR domain 0.028
Further Details:      
 
Domain Number 4 Region: 441-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000115
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 2054-2124
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000157
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 6 Region: 1333-1456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000087
Family SPRY domain 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016617
Domain Number - Region: 1128-1196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000174
Family Galectin (animal S-lectin) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016617   Gene: ENSMODG00000013282   Transcript: ENSMODT00000016922
Sequence length 4695
Comment pep:novel chromosome:BROADO5:4:382577711:382670496:1 gene:ENSMODG00000013282 transcript:ENSMODT00000016922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGEGEDDVQFLRTEDEVVLQCSATTLKEHIKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAVCCFVLEQSLSVRALQEMLANTVEAGTESSQGGGHRTLLYGHAILLRHAHSRMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQADASFMQTLWNMNPICSELIPSLPTGYVTGGHVLRLFHGHMDECLTISSA
DSDDQRRLVHYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALTED
QGLIVVDAAKAPTKATAFCFRVSKVPVEKLDTAPKRDVEGMGPPEIKYGESLCFVQHVAS
GLWLTYAAPDPKALRLGLMKRKAMLHQEGHMDDALSLTRCQLEESQAARMIYSTAGLYNQ
FINGKPKGAAAAGVALPIEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQE
EGMLTLVLNCIDRLNVYSTAAHFAEYAGEEAAESWKEIVNLLYELLASLIRGNRTNCALF
SHNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVL
DVLCSLRECEWRHPPFRTLLPPLSISISLLPLSALCISFILYLILYTSLPSIRPNIFVGR
AEGTTQYGKWYFEVMVDSVEPFLTAQSTHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLY
SYGFDGLHLWSGRVARPVASPGQHLLAAEDVVSCCLDLSVPSISFRINGCPVQGVFEAFN
LDGLFFPVVSFSAGIRVRFLLGGRHGEFKFLPPPGYAPCHEALLPRERLRLEPIKEYRRE
GPHGPHLVGPTCCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWT
YGPVRDDNKRLHPCLVDFHNLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEENLKK
TKLPKTYMMSNRYKPAPLDLSHVKLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQD
IPARRNPRLLGADDLAYVFNGHRVSTSCPPCPSPIFLNSASFHLTCSPKEESLFPHPSAE
GRVMLSAWASAERGKMGPRNYQGPSTTFLPSFLPLISILIPLSAFLQGQRWHMGSEPFGR
PWQPGDVVGCMIDLTENNILFTLNGEVLMSDSGSETAFKDIEIGDGFLPVCSLGLGQVGR
LNLGQDVGSLRYFTICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPMPPDHPHYEVTRVD
GTVDTPPCLRLTHRTWGSQNSLVEMMFLRLSLPVQFYQHFRYITMSETQTSEKAALRMGL
FCHLLSASPSTLQYYYSVRVFAGQEPSSVWVGWVTPDYHQYDMNFDLTKVRVVTVTMGDE
RGNVHNSLKRSNCYMVWGGDFVSPGQQGRISHTDMVIGCLVDLATGLMTFTANGKESNTF
FQVEPNTKLFPAAFVLPTNQNVIQFELGKLKNIMPLSAAMFLSERKNPAPQCPPRLEVQM
LMPVSWSRMPNHFLQVETNRAGDRLGWAVQCEDPLTMMALHIPEENRCMDVLELSERLSL
QRFHSHTLNLYRAVCALGNNRVAHALCSHVDQAQLLHAIEDAHLPGPLRAGYYDLLISIH
LESACRSRRSMLNEYIVPLTPETSTITLFPPGPSADPGEESPRRHGLPGVGTSTSLRPPL
HFSPPCFVAAPEGAGTAEAPARFSPSIPLEVLRDKALRMLGEAVRDGGQHARDPVGGSVE
FQFVPVLKLVSTLLVMGIFCDEDVKQILRMIEPEEGLLQMKLPESVKLQMCHLLEYFCDQ
ELQHRVEALIAFSERYVDRLQGNQRCRYGLLMRAFTMSAAETARRTREFRSPPQEQINML
LHFKGGEDEEECPVPDEVRQELLDFHQDLLLHCGIQLEGEEEEIEEETTLGSRLMNLLEK
VKLVKKKEEEPEDSPAPEEKKPGEEKSCPESLQELVSHTMVHWAQEDFIQNPELVRAMFS
LLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLESLCQIRSLLIVQMGPQEENLMIQSI
GNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRI
SRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYL
AGCGLQSCPMLLAKGYPDIGWNPGGGERYLDFLRFAVFVNGESVEENANVVVRLLIRRPE
CFGPALRGEGGSGLLAAMEEAIRISEDPARDGPGVRKDRRRDHHGEDAPEENRVHLGNAI
MSFYSALIDLLGRCAPETHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIPTLGKD
GALVQPRMSASFVPDHKAPMVLFLDRVYGIDSQDFLLHVLDVGFLPDMRAAASLDTVSDP
LPTASSTAPLWRMCPDDSHQRPLIPSSMEQRLPYDKAESSEKKKESSLAKASPTSPVRGR
MKRSALIVPRASSGRAPSSHLFGNKRLPCYLLPTHAPLLPKELFLGTKKYPAKPVHTLVP
SALVVYQLPPQEVEGSFPPSPLKSPPLTPALNRVLLLSVFYFMLLYKLFSDSGYFAWHHN
TTPIQDSHMPFLWPPHIDSHIPSLWCPHRRLPYAFSLPPPYWKSPCKTPIYLLFALLSPV
LSAPSLWAEHHHPTGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKD
MELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILL
PLINQYFNNHCLYFLSTPAKVLGSGGHASNKEKEMITSLIPLLPPLPHPQISLVLPWIPI
ESTWVSIIQSDALPCSPRTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQART
QVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKN
SYVEKLRPALGECLARVAAAMPVAFLEPHLNEFNACSVYTTKSPRERAILGLPSSVEEMC
PDIPDLKQLMAEIGGLAESGARYTEMPHVIEVTLPMLCNYLPRWWERGPEVPTSQPPGGP
PPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPT
VGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRA
HWLTEPNPDAEELFRMIAEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADSKSKMAKS
GGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIALAKTRYALKDTD
EEVREYLQNNLHLQGKSEGSPSLRWQMALYRGLPGREEDADDPEKIVRRVQEVSAVLFHL
EQVTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRASNMFLESYKAAWILTE
EHSFEDRMIDDLSVRWGPMGRGSPMAGHGGEESSIEVGMVIWQPFPNGILGRYKLDEDYL
YMAYADIMAKSCHLEEGEEASEPAEEEVEASFEEKEMEKQRLLYQQARLHNRGAAEMVLQ
MISACKGEPGAMVSSTLKLGISILNGGNIEVQQKMLEYLKDKKEVGFFQSIQALMQTCSV
LDLNAFERQNKAEGLGMVTEEGTVINRQNEENVTPAVEFPQSLFTSLCCCCGEGLIHYFQ
NYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIDEQGKRNFSKAMAVAKQ
VFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQLALLSILMGSRELLP
GWPISHVVGSILPTVNSFPSSILISPLSGPPSPLQFSSSQTSSLFKACFMVAPHLPLHWA
LFWACPPPPPFSAILHPGFHFSIFFSFIQHTPEDLCPGAPWGGDNEVLRLEGFFSSLAQW
IFMPQNLPTTHYSGQRNQDLIRPQRAHVPNTHRIPSQNHTSCLTLGLVSGSVTISQPLDR
SLCLCICLPQNQTLPLSTSYVHLSHCLSPLSDSPLLSSTLLSALDRKLLFRPIEVVSEWG
KPGVFNFPFIIPFCVCTLLFVFKNSLVRCFFFVYSFSYLIIGRLRRMMGYVLDPIRHTLD
YVDTQTDHRGYLHGMAGKQKEGIKIGGRKDLNNCPTDNWGRKQGWERILRETGLDREEDI
HRQRPTESSGMEGCREGMLVLQPSPEPEPEPEPEKADAENGEKEGPQEPEPEPPKKAAAP
SPPRKEDAKSEGPDFWEELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVSDS
PPGEEDLEGSGLEGLSGSGSGDFLGSGMGSGESTGYMEPALRGLSILHTLIAFLCIIGYN
CLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKR
KVLEKHGDIFGRERIAELLGMDLASLEITAQNEKRPEPPSGLLTWIMSIDVKYQIWKFGV
IFTDNSFLYLIWYLVMSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVG
LLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIE
DPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICG
IGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFF
PAGDCFRKQYEDQLA
Download sequence
Identical sequences F7A9X6
ENSMODP00000016617 ENSMODP00000016617 13616.ENSMODP00000016617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]