SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016625 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016625
Domain Number 1 Region: 2663-2786,2818-2963
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.3e-28
Family Nucleotide and nucleoside kinases 0.042
Further Details:      
 
Domain Number 2 Region: 2341-2611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-27
Family Extended AAA-ATPase domain 0.046
Further Details:      
 
Domain Number 3 Region: 1645-1866
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.62e-22
Family Extended AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 4 Region: 1908-2128
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-16
Family Extended AAA-ATPase domain 0.079
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016625
Domain Number - Region: 3170-3255
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016625   Gene: ENSMODG00000013290   Transcript: ENSMODT00000016930
Sequence length 4410
Comment pep:novel chromosome:BROADO5:1:315217798:315300194:-1 gene:ENSMODG00000013290 transcript:ENSMODT00000016930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLL
TLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVA
IFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEV
FQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAV
IVRVLRPQVTAVAQQSQGDVPEPPDIKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVS
KEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRG
AIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLT
AYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFT
IESTRVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAI
SLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIGEGIALVWESYKLDPYVQRLAET
VFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIW
VNKLDMEIERILGVRLQAGLRAWTQVLLGQADDKAEVDMDTDAPQVSHKPGGEPKIKNVV
HELRITNQVIYLNPPIEECRYKLYQEMFSWKTIILSLPRIQSQRYQVGVHYELSEEEKFY
RNALTRMPDGPVALEEAYSAVVGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKW
QALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGTNM
SEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEK
QRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRTVESRTTDLLT
DWEKTKPVTGNLRPEEALQTLTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERV
QVALEELQDLKGVWSELSKIWEQIDQMKEQPWVSVQPRKLRQNLDVLLNQLKNFPARLRQ
YASYEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDL
QKNEAVVKDVLLVAQGEMALEEFLKQVKVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEH
INSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHL
LPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLE
RERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSIVLGISSRE
GEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYIT
WIDKYQAQLVVLSAQIAWSENVESALTTIGGGGGDSVSPLQSVLTNVEVTLNVLADSVLM
EQPPLRRRKLEHLITELVHQRDVTRSLLKSKIDNSKSFEWLSQMRFYFDPKQTDVLQQLS
IQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKA
LGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCI
QEALREHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRS
LAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLV
SAGNVKRERIQKIKREKEERGEVVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLF
SLLSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINH
GLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDG
LFTHVLRKIIDNVRGELQKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPN
VRIMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRR
KGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLGSL
FSMLHQACRNVAQYNANHPDFPMQIDQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYI
RRITTVPLPNAPNIPIIDYEVSITGEWAPWQSKVPQIEVETHKVAAPDVVVPTLDTVRHE
ALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHY
CEYRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQ
TWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRL
IPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPV
EGLIRIWAHEALRLFQDRLVEDEERRWTDENIDMVALKHFPNIDKEKAMSRPILYSNWLS
KDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGV
SGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESN
VLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQV
IRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKP
NYIVPDYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLD
FINHYANLFNEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAAND
KLKKMVKDQQEAEKKKERSQEIQEQLHKQQEVIADKQMSVKEDLSTVEPAVIEAQNAVKS
IKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEE
ISDAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQK
LEDDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTAL
LKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQ
ANIQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATE
FIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGG
RVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLK
AERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKKEAA
EVTRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHN
VLYENPNLKGITDHTQRLSIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTIGE
PTYDAEFQHFLRGKEIVLSSGVLPKINGLTVEQTEAMMRLSCLPAFKDLVSKVQADEQFC
IWLDSSSPEQTVPYLWSEEKPATPIGQAIHRLLLIQAFRPDRLLAMAHMFVSTNLGESFM
SIMEQPLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFN
QADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNL
LRAGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAVIQERLRYAP
LGWSKKYEFGESDLRSACDTVDTWLDDTAKAKGRQNISPDKIPWSALKTLMAQSIYGGRV
DNEFDQRLLNTFLERLFTTKSFDSEFKLASKVDGHKDIQMPDGIRREEFVQWVELLPDTQ
TPSWLGLPNNAEKVLLTTQGIDMISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAW
MRTLHTTASNWLHLIPLTLNHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQ
VCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAA
ASGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTAQNAVLDAC
SFGVTGLKLQGATCHNNKLSLSNAISTILPITQLRWVKQTNAEKKANVVTLPVYLNFTRA
DLIFTVDFEIATKEDPRSFYERGVAVLCTE
Download sequence
Identical sequences F6ZK75
ENSMODP00000016625 ENSMODP00000016625 13616.ENSMODP00000016625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]