SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016666 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016666
Domain Number 1 Region: 138-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.4e-19
Family AN1-like Zinc finger 0.001
Further Details:      
 
Domain Number 2 Region: 18-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000599
Family A20-like zinc finger 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016666   Gene: ENSMODG00000013322   Transcript: ENSMODT00000016971
Sequence length 227
Comment pep:novel chromosome:BROADO5:2:277902682:278260647:1 gene:ENSMODG00000013322 transcript:ENSMODT00000016971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSTPSTSNSQSDLF
SGEMNSDNSNTSLTTPTVNSNQQQLSTELNVTSTGKEECGPCTDIAHVSLITPTKRSCGT
DSQSESEASPVKRPRLLDSNERPEEASRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVF
CMLHRLPEQHDCTFDHMGRGREEAILKMVKLDRKVGRSCQRIGEGCS
Download sequence
Identical sequences F7GJF9
XP_001370146.1.35504 XP_007483884.2.35504 ENSMODP00000016666 ENSMODP00000016666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]