SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016670 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000016670
Domain Number - Region: 631-706
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00136
Family Myosin rod fragments 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016670   Gene: ENSMODG00000013326   Transcript: ENSMODT00000016975
Sequence length 716
Comment pep:novel chromosome:BROADO5:6:287966555:288032774:1 gene:ENSMODG00000013326 transcript:ENSMODT00000016975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPGSGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKEH
SHRSYDRKWGQIHKWMEDAERARYSHRSSHHRPHLGVEDVLSPRNIGSHRPDPLKARPTQ
RSSSSRAYGDSNGTKRRPSSSHRDALKGLYYDQRNYSSLRPSKPPSAYSTRASSLYGEPP
ATSKTHGVSRAINSGLMRSASLASLGDVGLYSPYSSRTPSEYSYSSRASSSRSSPVFSDD
DTWSLASSDRGSHGPGASVVSAADCFGRSSRRGSVVSDVDDVIIPDVNSLDEKCDKQYAE
AYTRPSSRNFATTPLGSASRRVSGDTGSLVDPDSSLSDLRDIYDLKDQIQDVEGRYMQGL
KELKDSLAAVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVLEGQEEQMAEFYREHEEKS
KELERQRHLCTVLQHKMELLKEGLRQRDELIEEKLCMQQRIDTITKELFDLQETLIWKDK
KIGALERQKESFDCLRNERDALREELTELKDTLQTRQKHGLVIIPDGTPNGDVGHEPVVG
AITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKYSRHDGTF
GDLGGLENGADLQFIEMQRDANRQISEYKFKLSKAEQDMTTMEQNIGRLEGQVARYKTAA
ENAEKVEDELKADKRKLQRELRTALDKIEEMEMTNSHLVKRLEKMKANRTALLSQQ
Download sequence
Identical sequences F7GJ79
ENSMODP00000016670 13616.ENSMODP00000016670 ENSMODP00000016670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]