SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016763 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016763
Domain Number 1 Region: 11-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-47
Family Galectin (animal S-lectin) 0.0000727
Further Details:      
 
Domain Number 2 Region: 185-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-45
Family Galectin (animal S-lectin) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016763   Gene: ENSMODG00000013405   Transcript: ENSMODT00000017075
Sequence length 322
Comment pep:novel chromosome:BROADO5:4:382847031:382854150:-1 gene:ENSMODG00000013405 transcript:ENSMODT00000017075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFMPAPGYQPFYNPTLPYCREIPGGLRLGMSVYIQGTTNDHLKRFHVNFSTGPDPGSDV
AFHFNPRFDGWDKVVFNSMQSGRWGSEERKKSMPFKRGAPFELVIMVMSEHYKVVVNGNP
FYEYGHRMPIQMATHLQMDGDLQLQSINFLGGGPAPGQMPMPIPAYPGPGVTHSKPPLPS
MDGPPVFNPPVPFWGRIQGGLTPRKTIVIKGQVSQKANSVIINLKVASSGDLALHINPRL
SEGAVVRNSFMGGKWGSEERNMTFNPFIRGHFFDLSIRCGQDRFKVFANGEHVFDFGHRL
TAFHQVDTVEIQGDLTLSYVQI
Download sequence
Identical sequences F7CP16
ENSMODP00000016763 ENSMODP00000016763 XP_001362619.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]