SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016809 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016809
Domain Number 1 Region: 306-384
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.2e-20
Family Intermediate filament protein, coiled coil region 0.00081
Further Details:      
 
Domain Number 2 Region: 72-106
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000068
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016809
Domain Number - Region: 145-219
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016809   Gene: ENSMODG00000013441   Transcript: ENSMODT00000017121
Sequence length 442
Comment pep:novel chromosome:BROADO5:2:196566130:196613986:1 gene:ENSMODG00000013441 transcript:ENSMODT00000017121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRFSSSSRRVSSCGGAGSVRLSSGGAGLGAGNICSVFGSSSSGGGYGGGLGGGSSSCA
GFMGSEVGLLSGNEKVTMQNLNDRLASYLDNVRALEEANADLEQKIKGWYEKYGPGSCRG
LDHDYSRYFPIIEDLRNEIIAATISNASVVLQNDNARLTADDFRLKYETELALHQSVEAD
INGLRRVLDELTLCRTDLEIQAETLNEERTYLKKNHEEEMKVLQCTAGGNVNVEMNAAPG
VDLTVLLNNMRAEYEDLAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARSELTEMKRT
LQTLEIELQSLLATKHSLECSLTETEGNYCVQLSQIQAQIGALEEQLQQIRTETEGQKLE
YERLLHIKVSLEKEIETYCLLIDGDEGICKSGGHKSKDYGSGSQAKEPGKAIVVKKVLEE
IDQRSKVLTTRLQSLEEKTPSN
Download sequence
Identical sequences F7G9V1
ENSMODP00000016809 ENSMODP00000016809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]