SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016817 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016817
Domain Number 1 Region: 313-391
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-20
Family Intermediate filament protein, coiled coil region 0.00095
Further Details:      
 
Domain Number 2 Region: 79-113
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000246
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016817
Domain Number - Region: 127-226
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016817   Gene: ENSMODG00000013449   Transcript: ENSMODT00000017129
Sequence length 466
Comment pep:novel chromosome:BROADO5:2:196581512:196594235:1 gene:ENSMODG00000013449 transcript:ENSMODT00000017129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRLSSGSRRICSRPGSVRLSSCGGGFGAGNSCGGGSGVGSSFSGTLGGASSGGSYSGG
LGSGGCAGFLGNENGLLSGNEKVTMQNLNDRLASYLENVKALEEANADLEQKIKGWYEKY
GPGSCRGLDHDYSRYFSIIEDLKNEIISATACNANVVLQNDNARLTADDFRLKYENELAL
HQSVEADINGLRRVLDELTLCTTDLEIQYETFSEELTFLKKNHEEEMKVLQCAAGGNVNV
EMNAAPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNEKSATLQQQISDDVGATTAARNE
LTELKRSLQTLEIELQSLMAMKHSYECSLAETEGNYCLQLSQIQDQIGALEDQLQQIRME
TEGQKLEYDHLLDIKIYLEKEIETYCCLIDGEERDCKSTCQKSKSYETAKPGNQVKDSAQ
STVVKTVVEERDSNGPVLSVKVHSVEEKSSKISNITMEQRVPSKAP
Download sequence
Identical sequences F7G9J2
XP_001365658.1.35504 ENSMODP00000016817 ENSMODP00000016817 13616.ENSMODP00000016817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]