SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016826 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016826
Domain Number 1 Region: 328-406
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.67e-21
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 94-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000046
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 140-241
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000523
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016826   Gene: ENSMODG00000013455   Transcript: ENSMODT00000017139
Sequence length 474
Comment pep:novel chromosome:BROADO5:2:196541571:196555001:1 gene:ENSMODG00000013455 transcript:ENSMODT00000017139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSKAMSLRISTGPRRICSWSGAGAVRIPNASTSFGNNSMYGGSVVGGGNLPGGSYGSCL
SGSSGGAPSGNPVVSSFGSASGAGFVGNEGLLSGNEKVTMQNLNDRLASYLDNVRALEEA
NSELEQKIKGWYEKFGPGSCRGLDHDYSRYQVTIEELKNKLISSTTSNANVVLQIDNARL
AADDFRLKFENELAFHQSVEADINGLRRVLDELTLCRTDLEIQYETMNEELTYLKKNHEE
EMKALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEDLAEQNRRDAEAWFNEKSATLQQ
QISDDAGATTSARSELTEMKRTVQTLEIELQSLLATKQSLECSLRETEGNYCVQLSQIQN
QIGALEEQLQQVRTETEGQKLEYEQLLDTKIHLEKEIETYCRLIDGDGSSCSKTKSYESG
VPGSSIKDLSKTTLVKTVVEELDQRGKVLSTRVHSIEEKTTKMSNGKTEQRVPF
Download sequence
Identical sequences F7G996
ENSMODP00000016826 ENSMODP00000016826 13616.ENSMODP00000016826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]