SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016844 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016844
Domain Number 1 Region: 1382-1609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-39
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 422-534
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-28
Family Cadherin 0.00056
Further Details:      
 
Domain Number 3 Region: 527-631
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-28
Family Cadherin 0.00092
Further Details:      
 
Domain Number 4 Region: 837-943
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-28
Family Cadherin 0.00052
Further Details:      
 
Domain Number 5 Region: 1625-1832
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.56e-25
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 6 Region: 314-420
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 944-1044
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-25
Family Cadherin 0.00094
Further Details:      
 
Domain Number 8 Region: 209-312
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0022
Further Details:      
 
Domain Number 9 Region: 735-837
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-24
Family Cadherin 0.002
Further Details:      
 
Domain Number 10 Region: 633-733
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-21
Family Cadherin 0.0007
Further Details:      
 
Domain Number 11 Region: 3763-3793,3868-3942
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 
Domain Number 12 Region: 1321-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 13 Region: 1046-1148
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000571
Family Cadherin 0.0099
Further Details:      
 
Domain Number 14 Region: 1867-1910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000567
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 15 Region: 1831-1865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000163
Family EGF-type module 0.023
Further Details:      
 
Domain Number 16 Region: 1961-2000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000418
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016844
Domain Number - Region: 1300-1328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0057
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 1990-2055
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00759
Family Hormone receptor domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016844   Gene: ENSMODG00000013462   Transcript: ENSMODT00000017157
Sequence length 3948
Comment pep:novel chromosome:BROADO5:6:201311178:201386250:-1 gene:ENSMODG00000013462 transcript:ENSMODT00000017157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTLALCPEILGGVKTGSGTRSGGRVPSGLPKNGRGGSGLRHTEQGPQPREGSPGTGSREE
RPGGPGSWPLLCWAREAVSCRRPGPGRCLASGAQSPGPLASGRGGPPHAGSLSEALPFRL
RFPRFLQASEPGQKVRRGGRERLGTVQAVSCGDEAFGLPRTGESASAPRAAGTAPDALAQ
RRRLRPRGLLCCAPPSVPHARSRRAANRHPHFPQYNYQAQVAENQAPGTPVLSVAAQDPD
AGEAGRLIYSMAALMNSRSMELFRIDSTNGLISTVEPLDRESMDLHYFRVTALDHGSPRL
SATTMVAVSVTDRNDHSPVFEQAEYRETIRENVEEGYPILQLRATDGDAAANANIRYRFV
DPPAAQAVFEIDPRSGLITTSGRVDREQKENYELAVEASDQGGEPGPRSATVRVHITVLD
ENDNAPQFSEKRYLAQVREDVRPHTEVLRVTATDLDKDTNALVHYNIISGNSRGHFAIDS
LTGEIQVVAPLDFEVEREYALRIRAQDSGRPPLSNNTGLASIQVVDINDHAPIFVSTPFQ
VSVLENAPLGHSVIHIQAVDADHGENARLEYKLTGMALDTPFVVNSATGWITVSGPLDRE
SVEHYFFGVEAVDHGSPPLSASASVTITVMDVNDNRPEFTQKEYHLRLNEDAAVGTSVLS
VTAVDRDINSAISYQITGGNTRNRFAISTQGGMGLVTLALPLDYKQERYYKLILTASDRT
LHDNCYVHINITDANTHRPVFQSAHYSVSVNEDRPVGSTVVVISATDDDVGENARITYLL
EDNLPQFRIDVDSGAITLQAELDYEDQVTYTLAITAKDNGIPQKADTTYVEIMVNDVNDN
APQFVASYYPGVISEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSG
IVRTVRRLDRETVPVYELTAYAVDRGIPPLRTPVNIQVTVQDVNDNAPVFPAEEFEVRVK
ENSIVGSVVAQITAIDPDEGPNAQVMYQIVEGNIPELFQMDIFSGELTTLIDLDYEVRPE
YVIVVQATSAPLVSRATVHVRLIDQNDNSPVLKNFQILFNNYVSNRSNTFPSGIIGRIPA
YDPDVSDRLFYTFERGNELELLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTA
QCVLRVTIITEDMLANSLTVRLENMWQERFLSPLLASFLEGVATVLATPKEDVFIFNIQN
DTDVGGSVLNVSFSALAPGGGAPGAGGGGGPFFSSEELQEQLYVRRAALAAASLLDVLPF
DDNVCLREPCENYMKCISVLRFDSSAPFLASASTLFRPIHPIAGLRCRCPLGFTGDYCET
EINLCYSNPCRNGGACARREGGYTCICRPHFTGENCELDSRAGRCVPGVCRNGGTCTNTP
SGGFRCQCPGGGGFEGPYCEVAVRSFPPNSFLMFRGLRQRFHLTLSLSFATVRSHGLLFY
NGRLNEKHDFLALEIVAGQVRLTYSTGESSTVVSPIVPTGVSDGQWHTVQLRYYNKPRTS
ALGGVQGPSKDKVAVLSVDECDTPVALQFGAEISNYSCAAEGVQTSSKKSLDLTGPLLLG
GVPNLPENFPVSHKEFVGCMKDLFIDSRRVDMAAFVANNGTTPGCQAKRTFCNSSPCRNG
GTCSDGWAGFRCACPVGFGGKDCGLAMVHPYRFRGNGILSWDFGSEATISVPWYLGLAFR
TRAPHGVLLQIQAGQHNSLLCQLEKGLLSLVVEKGSGRTARLLLDQVTLSDGQWHDIRLE
LQDGRAGRSGHYLLTVTVDFGLFQDTMAVGSELHGLKVKHLHVGGLLKAHEVHRGLDGCI
QGVWLGAMPSGAPALPPPSSKMNAEPGCNVLNPCASKPCPVHADCQDEWQTFSCICHQGY
YGKACVDACHLNPCKNKGACQRRVGAPRGYTCECEDGHFGPHCEHRMDQQCPRGWWGSPA
CGPCNCDVNKGFDPDCNKTNGQCSCKEFHYRPRGSDTCLPCDCYPVGSSSRSCSQDSGQC
PCRPGVIGRQCNSCDSPFAEVTASGCRVLYDGCPKSLKGGVWWPQTKFGHLATVPCPKGS
LGAAVRCCDEDRGWRSQTLHCTSPAFRELGLLLDDLERNETELDTIEAKKLAQRLRAVTG
HTERYFGNDIHIAARLLGRLLAFESHQQGFGLTATQDAHFNENLLWAGSAVLGPETRKLW
DSPQPRIPGGTTARGSSAGLIEQLEEYTATLAQNMELTYLNPVGLVAPNIMLSIDRMESP
VPSLGGHRYPRYHGSLFRGQDAWDPHTHVVLPSPVSRPPQPEALPTSGSSDANETAESVA
ARGGHLEAEPGLTIVILLIYRTLGALLPARYQAERRSVRLPRNPVMNSPVVSVSVFRERG
FLQGVLESPITLEFRLLQTANRSKPLCVQWERPSPSDSWGVWTARDCELVHRNGTHVHCQ
CSRLGTFGVLMDASHRERLEGDLALLAIVTHVTVSVTVASLLLTVAVLLSLRGLKSNTRG
IHANVAAALGLAELLFFLGIYRTHNQVLHWRGHNTGKPSGFLCTVIAIVLHYLFLGAFSW
LFVQGLHLYRMQAEARNVDLGAMRFYYALGWGVPAILLGLAVGLDPGGYGNSDFCWISIH
DKLVWSFAGPIILVILMNGVLFLLVARMSCSPGQREAKRIRSSARLYRGSFLLLLLISAS
WLFGLLAVNHSVLAFHYLHAGFCGLQGPAVLLLFCVLNEETRGAWASACLGRKAGTEEAR
PAAGTGPGAYNNTALFEESGLIRITLGASTVSSVSSARSARTQDSQRGRGGLLRENVLAK
HGSMADHTDQSLLAHGGPTDLDVAMFHRDAGGGMDSDSDSDLSLEEDRSLSIPSSESEDN
VRPRGRFQHPLRRAAHSERLLTHPASSTPKDVDGNDLLSYWPALGDCEVHPCSLQTWGSE
RRLGLDTSKDAANNNQTELALTSGDENTIGHTQLSHTQRQRKGILKNRLQYPLALHGLPS
ASARGAPELSWYRSSTLGHRAVPAASYGRIYSGTGSLSQPASRYSSREQLDLLLRRQMSR
EQLEEATPLPISSSRHGSWEHLEACLSGPEPRFRGSTLPRRQPPRDHLDALATRFGSREP
LDSGASQEWPSPLPHLRGSRDQLLPTRQRSREQLDCLARSSNSPEQLDMRPCRHPSRENL
EPLSRRLPSRENVAACPSRPPSTEQLDILSSILASFNSSALSSSVQSSSTPSGPHTTATP
SATASAPGHSTPRSATSHSISELSPDSEPRDTQALLAFQDPPMEKSELELDPQQCDYHVD
RQILNEQALEETGQRSRSPKSFRCTPPRLECSKAIAWATLQRFLPILSWLPQYPAREWLL
GDLLSGLSVGIVQLPQGEALQGGLAYALLAGLPPVYGLYSSFYPVFVYFLFGTSRHISVE
SHCVLWSPGAFAVLSVMVGSVTEALVPSDSFLGPGNSSVNVSARDAARVEVASALSLLVG
VFQIGLGLIHFGFVVTYLSEPLVRGYTTAASVQVLVSQLKHVFGLDPEDYSGPLSMIYIL
LDILWKLPKSNVSTIIVALVASVLLLAMKMINQKLDKKLPVPLPAELIMLIGATAISFGV
GLNHKFGVGIVGDIPAGLMLPRIPDHHLFKNLMGNAFAMAVVGFAIAISLGKIFGMKHGY
EVDNNQELIALGLSNFVGGFFHCFPISSSMSRSLVQEGSGGNTQIAGAISSLLILIVIVK
VGELFNHLPKAILAVIVIINLKGMFLQFSDIKSLWKSNRVDLLIWLVTFVATILLNLDIG
LAVAVGFALISVIFRTQLPHYSILGQVPDTDIYRDVTEYKEAKEVPGVKIFSCSATLYFA
NAEFYRQALKEKIGLDVDFLISKKKKLIKRQTWNAKKLPKGKKQKKVGLILEGCLGVLSG
PKTCQGSGSHLVSEKGSSALTLETLGLPQPNFHTLILDLGTLNFVDTVCIKTLKNIIRDF
QEVEVNVYLAGCHGTMITQFESGNFFGDSITKGHLFVSIHDAVTFALK
Download sequence
Identical sequences F7FMZ2
13616.ENSMODP00000016844 ENSMODP00000016844 ENSMODP00000016844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]