SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016896 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016896
Domain Number 1 Region: 317-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-29
Family SPRY domain 0.06
Further Details:      
 
Domain Number 2 Region: 515-566
Classification Level Classification E-value
Superfamily RING/U-box 0.00000209
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016896
Domain Number - Region: 159-299
Classification Level Classification E-value
Superfamily ARM repeat 0.000524
Family Clathrin adaptor core protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016896   Gene: ENSMODG00000013505   Transcript: ENSMODT00000017209
Sequence length 574
Comment pep:novel chromosome:BROADO5:1:448312699:448375223:1 gene:ENSMODG00000013505 transcript:ENSMODT00000017209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFAWVVFYASRSLVQGLLLTLEQHITNFLGTLGATNMGNSCICREDSGTEDNAESQHQ
QTENSVLPAAENRSHPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEP
PYSMITLHEMAETDEGWLEVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEI
LNLNGAVACHDASHPAKHRNTTAVLGLLEKLPGPASISLLSPGILEYLLQSLNFRSHPTV
MLFALIALEKFAQTSENKMTVSKSCISDRLVMLESWTENSDYLKRQVGFCAQWSLDNLFL
KEGRQFTYEKVDLTNIRAMLNSNDVSEYLKISPNGLEARCDASSFESVRCTFCVDSGVWY
YEVTVITSGVMQIGWATKDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHSHPCW
KEGDTIGFLLDLQEKQMIFCLNGNQLPSEKQVFTSAVSGFFAAASFMSYQQCEFNFGAKP
FKYPPPIKFSTFNDYAFLSAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTELKPC
GHSDLCMDCALQLETCPLCRQEIVSRVRQISHIS
Download sequence
Identical sequences F7F8B9
13616.ENSMODP00000016896 ENSMODP00000016896 ENSMODP00000016896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]