SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016913 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016913
Domain Number 1 Region: 337-414
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.05e-21
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 104-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000136
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016913
Domain Number - Region: 162-251
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00131
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 219-335
Classification Level Classification E-value
Superfamily Prefoldin 0.018
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016913   Gene: ENSMODG00000013512   Transcript: ENSMODT00000017226
Sequence length 473
Comment pep:novel chromosome:BROADO5:2:196513534:196518891:1 gene:ENSMODG00000013512 transcript:ENSMODT00000017226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CITMSQRYGSSRHYSSSRSGGGAGGGSSIRISSTRGSGYGAGSIGGGFSSAGGFGSRSVG
GFVGGFSSSSYGGGSFGGSYGGVSCGGGSFGGLFDGSDGGLLSGNEKVTMQNLNDRLASY
LDKVKALEDSNSQLEQKIKEWYEKYGNSRQREPRDYSHYYDVIKDLKDQILTLTTDNANV
LLQIDNARLAADDFRLKYENEVALHQSVEADINGLRRVLDDLTLAKTDLEVQLESLNEEL
AFLKKNHEEEMKDLQNVSTGDVNVEMNAAPGVDLTENLNLLRSQYEQLAEQNRKEAEAWF
NEKSKELTTEINSNVEQVSSQKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRY
CSQLSEIQAQITALEEQLQQVRAETEYQNSEYQLLLDIKIRLENEIQTYRSLLEEGGGIS
GGVQGASSSSGAYGGSSAGSGGVTSSGPRRGSSVVQGGSSGSGGESTSKSSSG
Download sequence
Identical sequences F7D750
ENSMODP00000016913 13616.ENSMODP00000016913 ENSMODP00000016913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]