SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016949 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016949
Domain Number 1 Region: 334-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.12e-21
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 101-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016949
Domain Number - Region: 160-248
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 216-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0162
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016949   Gene: ENSMODG00000013542   Transcript: ENSMODT00000017262
Sequence length 491
Comment pep:novel chromosome:BROADO5:2:196492859:196499840:-1 gene:ENSMODG00000013542 transcript:ENSMODT00000017262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRYGSSRHYSSSRSGGGAGGGSSIRISSTRGSGYGAGSIGGGFSSAGGFGSRSVGGFV
GGFSSSSYGGGSFGGSYGGVSCGGGSFGGLFDGSDGGLLSGNEKVTMQNLNDRLASYLDK
VKALEDSNSQLEQKIKEWYEKYGNSRQREPRDYSHYYDVIKDLKDQILTLTTDNANVLLQ
IDNARLAADDFRLKYENEVALHQSVEADINGLRRVLDDLTLAKTDLEVQLESLNEELAFL
KKNHEEEMKDLQNVSTGDVNVEMNAAPGVDLTENLNLLRSQYEQLAEQNRREAEAWFNEK
SKELTTEINSNVEQVSSQKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCSQ
LSEIQAQITALEEQLQQVRAETEYQNSEYQLLLDIKIRLENEIQTYRSLLEEGGSANSAA
IGHGGSSGGTYRGISGGVQGASSSSGAYGGSSAGSGGVTSSGSRRGSSVVQGGSSGSGGE
STSKSSSGTRF
Download sequence
Identical sequences F7CLT7
ENSMODP00000016949 XP_007482312.1.35504 ENSMODP00000016949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]