SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016954 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016954
Domain Number 1 Region: 371-448
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-22
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 138-173
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000455
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016954
Domain Number - Region: 195-285
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016954   Gene: ENSMODG00000013548   Transcript: ENSMODT00000017267
Sequence length 538
Comment pep:novel chromosome:BROADO5:2:196466251:196520400:1 gene:ENSMODG00000013548 transcript:ENSMODT00000017267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRYGSSKNFSSSRSGGGGSSSIRISSSRGSSYGGGSVGGRFISTGSSSYGSCSRGGYG
GGSLGGFGGGFGGGSCGGGSFGGGYGGGSCGGGSFGGGYGGGSFGGGSFGGGSFGGGSFG
GGLLGGSFGGGDGGLLSGNEKVTMQNLNDRLASYLDKVKALEDSNYELEQKIKEWYEKNG
NSRQREPRDYSNYYDTIADLKNQILNLTNDNANVLLQIDNARLAADDFRLKYENEVALRQ
SVEADINGLRRVLDDLTLAKTDLEMQLEGLSEEMAFLKKNHEEEMKDLQNVTTGDVNVEM
NAAPGVDLTQYLNRMRNEYEQLAEQNRRDAEAWFNEKSKELTTEIDSNVEQMSSHKSEIT
ELRRNVQALEIELQSQLALKQSLEASLAETEGRYCSQLSQIQVQITALEEQLQQIRAETE
CQNSEYQMLLDIKIRLENEIQTYRSLLEEGGSGGSYGGGSRGGSSGGGYGGSSGGGGYGG
SSGGGQGGGSSSGGYGGSSGGSGEFKSSGSRGGSSGRQGGSSGSGGESPSKSSSGTRF
Download sequence
Identical sequences F7C3I4
ENSMODP00000016954 XP_001369401.2.35504 ENSMODP00000016954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]