SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016956 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000016956
Domain Number - Region: 408-513
Classification Level Classification E-value
Superfamily Tropomyosin 0.000196
Family Tropomyosin 0.005
Further Details:      
 
Domain Number - Region: 314-392
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00254
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016956   Gene: ENSMODG00000013551   Transcript: ENSMODT00000017270
Sequence length 548
Comment pep:novel chromosome:BROADO5:1:448791030:448815712:-1 gene:ENSMODG00000013551 transcript:ENSMODT00000017270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHSASSRLADSPQLSKSSLLNILGSPSPERMGLADSLPPTPQSGTPSPGPPPLPLLRGG
SPGLDGDWESREELRLRELEEARARAAQMEKTMRWWSDCTANWREKWSKVRAERNKAREE
VRQLRQKLEALTKELTGARRERQEALNQSEQLGKEVARLKGARLQEEEEDHREGEEAHEE
QEPVRDVGSEKPGKNKELELMENLLKSKQEGPENWETRSMADVRATFSRQERSRAPPLCP
AASGSAQGVSWSAHRQQSWRGAECLGHSPPPFSGHSSLHPPLYPTAQWKLFFSPLCGVKW
DGVYPLNILKEMHQDELGRISEDLEDELGARSNMDKKIAELRSEMERLQAENAAECRRRE
QLETDMTGLKRLSRGCFGMVRDLKQGIKKKKSPLASLIEIFLRRRKASQSQKVSEELADL
KHVHTKLKKQCQEKMAELAHANRRVEQHEGEVKKLRLRVEELKKELAQAEDELDEAHNQA
RKLQRSLDEQTEHSENLQVQLEHLQSRLRRQQNAPLFGKIRSSRFGSEEPGDGTSDLDED
EDLQIQVP
Download sequence
Identical sequences F7C3G0
13616.ENSMODP00000016956 ENSMODP00000016956 ENSMODP00000016956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]