SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016960 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016960
Domain Number 1 Region: 359-437
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.71e-24
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Domain Number 2 Region: 126-161
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000785
Family Intermediate filament protein, coiled coil region 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016960
Domain Number - Region: 178-273
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000915
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016960   Gene: ENSMODG00000013554   Transcript: ENSMODT00000017274
Sequence length 496
Comment pep:novel chromosome:BROADO5:2:196403787:196413370:1 gene:ENSMODG00000013554 transcript:ENSMODT00000017274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCIDTMSLSVYNSGASRQTSSRSGVGGRRLSHLSSSSSGGGFGSGACSGGSFSAASMFGS
SCGFGSSSGNAFGGGLGSGYGAGLGSGYAVGLGSGYGSGLGNSYGGGLGSGSMGISCSND
GGLLSGSEKETMQNLNDRLASYLTKVRALEEANTELENKIRDWYETRITGDSVSRNEYEK
YYPLIEDLRNKIISATIENARLILQIDNARLAADDFRMKYENEQALRQNVEADINGLRRV
LDELTLARTDLEMQIEGLMEELAYLKKNHEEELQAIQAGGPGHVSVEMDAAPGINLTKLL
NDMRGQYETIAEQNRKEAEAWFIEKSGELKKEISHNTEQLQTSKSEITDLKRTLQSLEIE
LQAQLAMKKSFEDTLAETEGGYCNQLSQIQFQIGSLEAQLSQVRCDMERQNAEYEQLLNI
KTRLEMEIETYRQLLEGELEGNDAVENLNVPESNSQAQSIDSSKDPARTRKIKTIVQEVV
DGKVVASEVREIEEEI
Download sequence
Identical sequences F7C3D4
ENSMODP00000016960 13616.ENSMODP00000016959 ENSMODP00000016959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]