SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017004 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017004
Domain Number 1 Region: 327-398
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.2e-20
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 87-121
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000628
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017004
Domain Number - Region: 143-230
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00194
Family Myosin rod fragments 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017004   Gene: ENSMODG00000013596   Transcript: ENSMODT00000017319
Sequence length 431
Comment pep:novel chromosome:BROADO5:2:196193408:196200935:1 gene:ENSMODG00000013596 transcript:ENSMODT00000017319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSECPPKSDTPESCSKASDHSSVSTHSTEIPCLPSTGVTSRCQTPTFFARSCQPTSCLA
TCYLHGSCNIPCVVGSCGWGEEGVFNSNEKETMQFLNDRLACYLERVRGLEQENAALECK
IREQCEPEVPLMCLDYQCYFDTIENLQQKILCTKAENSRLAVQIDNFVLAVDDFRSKYEA
ELSLRQQAEADIKGLRKILDDLTLCKCDLEAHVESLKEDLLSLKKNHDEEVCLLKEQLGD
RLNVELDTAPPVDMNKVLDDMRCQYEMVVADNRRDVEQWFTLQTEELNQQQLSSSEELQC
CQSEVLELKRTANALDIELQAQHGLIESLECTQAETEAQYSTQLAQMQCLIDNVESQLAG
IRCDLERQNQEYQVLLDMKALLECEIATYQSLLESEDSKLPCNPCSSSTTSGNTCEPCTA
CLICTVEGCQV
Download sequence
Identical sequences F6VVV1
XP_001369256.2.35504 ENSMODP00000017004 ENSMODP00000017004 13616.ENSMODP00000017004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]