SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017029 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017029
Domain Number 1 Region: 8-362
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 1.44e-96
Family Glutaminase/Asparaginase 0.0000001
Further Details:      
 
Domain Number 2 Region: 391-553
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.39e-31
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017029   Gene: ENSMODG00000013615   Transcript: ENSMODT00000017345
Sequence length 561
Comment pep:novel chromosome:BROADO5:1:311198283:311340305:-1 gene:ENSMODG00000013615 transcript:ENSMODT00000017345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSGEHVRRLLAIYTGGTIGMRNREGVLVPESNLLTTLRKLPMFNDEEYSREHQLQDDT
LALPLTNQNQRIIYTILEYDPLFDSSDMTINEWIRIAQDIERNYEQYFGFVVIHGTDTMA
FASSMLSFILGNLQKTVILTGAQVPIHTLWNDGQENLLGSLLMAGQYVIPEVCLFFQNQL
YRGNRVTKVDSRRFSAFCSPNLSPLATVGVDIIVNHKIMLKASMNKQLMVHSNMERNVGV
LRLYPGISAALVRAFLQPPMKGVVMETFGTGNGPTNSDLLSALKEATERGMVIVNCTQCL
QGSVTSDYAAGMAISDIGIISGSDMTSEAALAKLSYVLGREDLTLKDKKELLTKNLRGEM
TPQPERVQLSLRNSKFAQLITNFLYLNCSQDLDAVRDSLTPTLACAAARMGDVEALEAII
ELGGDLSESDFDGRTPLHMAARGGHVDAVQCLLSHGANVNSLDGDRSSPLLMAVKGRHKD
VIFLLRDAGAQLSPPELQDAGTELCRLAASGDRDGLIAWQRAGADLFQTGYDGQTPLQVA
EDAGNQEVVNFLKSPWDGGQV
Download sequence
Identical sequences F6VF13
ENSMODP00000017029 XP_007473538.1.35504 ENSMODP00000017029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]