SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017156 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017156
Domain Number 1 Region: 46-527
Classification Level Classification E-value
Superfamily Cytochrome P450 2.75e-119
Family Cytochrome P450 0.0000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017156   Gene: ENSMODG00000013723   Transcript: ENSMODT00000017475
Sequence length 527
Comment pep:novel chromosome:BROADO5:8:202036869:202302100:1 gene:ENSMODG00000013723 transcript:ENSMODT00000017475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTMEFLKFFNLEVNGTMVTMALVLVLLVLLKWYSTSAFSSLERVGIRHPKPLPFIGNLT
FFRQGFWESHMELIKTYGPLCGYYLGRRMYIVVYEPQMIKEVLVKNFGNFTNRMMSGLET
KPIADSILFLRNKRWEEVRSTLTPAFSPKKLDEVIPLISQACDLLLTHLKPYAESGEAFD
IQRSYGCFTLDVVASVAFGFQVDSQKRPEHPFVKHCRRFFQFSIPKCVLILIFAFPSIMI
PLSRVLPNKNRDELSAFFNNVIRNMITLRDKQAEEERRRDFLQILLDARGAPSSAEVSQS
AQNGDSSIPQATSRVLQKTLTTDEIVGQAFIFLIAGYETITNTLSFVTYLLATNSECQEK
LLREVDEFSERNAVPKFCTLEEELPYLDMVIAETLRMYPPAFRFTRETEKDCDVMGLHIP
AGAIVEMAVGYLHHNPEYWPNPETFIPERFSLEARQQHLPFTYLPFGAGPRSCIGVKMAM
LEMKLTLLRLLQKFKFEICPETQVPLQLKSRSALGPQNGVYIKIVSR
Download sequence
Identical sequences F6XRJ4
ENSMODP00000017156 ENSMODP00000017156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]