SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017178 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017178
Domain Number 1 Region: 519-708
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.09e-58
Family Hemopexin-like domain 0.00000049
Further Details:      
 
Domain Number 2 Region: 113-221,397-451
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.31e-47
Family Matrix metalloproteases, catalytic domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 279-336
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-21
Family Fibronectin type II module 0.00018
Further Details:      
 
Domain Number 4 Region: 337-392
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-20
Family Fibronectin type II module 0.0003
Further Details:      
 
Domain Number 5 Region: 222-277
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 6 Region: 40-108
Classification Level Classification E-value
Superfamily PGBD-like 1.44e-19
Family MMP N-terminal domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017178   Gene: ENSMODG00000013741   Transcript: ENSMODT00000017497
Sequence length 709
Comment pep:novel chromosome:BROADO5:1:449604034:449610513:1 gene:ENSMODG00000013741 transcript:ENSMODT00000017497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLWLFLDLLFLVLGCCSAAPRGGPSPGSILITFPEERTRTLTDQQFAEEYLLRYGYIP
AGLLGQNHTSLKHALKKLQRQLALTQTGELDSATIEAMRAPRCGVPDVAPFQTFEGELKW
KHQNITYRIQNYSPDLPPEVTDDAFQRAFALWSKVTPLTFTRVSSGEADILIQFGTREHG
DGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEEFWTLGKGVVVKTRFGNADGAPCHFPFTF
EGSSYSACTTDGRSDGLHWCSTTADYDKDRLYGFCPSELLYTLDGNANGDPCVFPFTFDG
RSYTACTTEGRSDGYRWCATTASYDQDKLYGFCPNRDTAVSGGNSQGEPCVFPFTFLNRE
YSACTSEGRSDGRLWCATTDDFDRDHKWGFCQDRGYSLFLVAAHEFGHALGLDHSSVPEA
LMFPMYRFTEGPPLHEDDVKGIQHLYGSRTEPDPEPPTSSPLEPDSTTQFNACPSVPPPA
RPTGPPTARPSAPPTAGPTGPPTANPPVPPTGPLDPADDACGVLVFDAIAEIRGQLHFFK
DGRYWRVPRDSKGPTQGPFLIANTWSALPPKLDSAFEDPLTKKLFFFSGQKMWVYTGQSV
VGPRRLEKLGLHSRVQRITGAIQHNGGKVLLFSQNQYWRLDVKKQKVDSREPYPVENMFP
GVPENTHDVFLYKGDTYFCQGIFFWRVNKENKVDLVGYVTYDLLHCQED
Download sequence
Identical sequences F6X875
ENSMODP00000017178 XP_007474988.1.35504 ENSMODP00000017178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]