SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017253 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017253
Domain Number 1 Region: 59-257
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 1.83e-45
Family Apolipoprotein A-I 0.00036
Further Details:      
 
Domain Number 2 Region: 207-361
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 2.22e-33
Family Apolipoprotein A-I 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017253
Domain Number - Region: 25-72
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 0.00484
Family Apolipoprotein A-II 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017253   Gene: ENSMODG00000013802   Transcript: ENSMODT00000017572
Sequence length 371
Comment pep:novel chromosome:BROADO5:4:233890153:233894397:1 gene:ENSMODG00000013802 transcript:ENSMODT00000017572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLKAVLLSLAFVAIASVQAETQPDQISQIVWDYFNKLSANAKDAMEQLQNSELNQQFNT
LLQDKLGEVSTRTNDLTKKILPFAMELPTRLVQDSERLKTQIQREMEELRVQIQPFAEQV
NQKMTDNVQTLKKHVVPYTSELQTHLSENVEQLQQQLAPFVQQLDEAMKENLKSLQTDII
PLANQFKDKVNQQVDNIKGQLIPYADRIQGKIDEHIEELRKTLTPFATGAQDQLNRQLES
LAFQMKKNVEQLRTKISENTEDLKQKLTPFAEDIQGKIPGNSEELYQSLTKVRGQMNQHI
EEFRRNIGPQGEAFNTALVQHLEELKKKLGSHSGEIEDHLGLLEKGLRDKVNSFFSSLQE
SQEEMPADPKP
Download sequence
Identical sequences F6TDB8
ENSMODP00000017253 XP_001380874.1.35504 ENSMODP00000017253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]