SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017288 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017288
Domain Number 1 Region: 821-928
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-22
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 2 Region: 28-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 294-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 256-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000636
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 633-748
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000144
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000369
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 201-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017288
Domain Number - Region: 760-815
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0334
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017288   Gene: ENSMODG00000013831   Transcript: ENSMODT00000017607
Sequence length 1005
Comment pep:novel chromosome:BROADO5:2:274091822:274145655:1 gene:ENSMODG00000013831 transcript:ENSMODT00000017607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGSASGLCLLLVLVHARASQQSKASQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YSGDGKHCKDVDECERDDNAGCVHECVNIPGNYRCTCYDGFHLAHDGHNCLDLDECAEGN
GGCQQSCVNMMGSYECLCRDGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPKCGCHVKFVLHTDGKTCIGER
RLEQHIPPQAVSNETCAVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLN
NGGCDHICRNTVGSFECSCKKGYKLLINERSCQDIDECSFDRTCDHICVNTPGSFQCFCH
RGYLLYGLTHCGDVDECSINRGGCRFGCINTPGSYQCTCPSGQGRLHWNGKDCTELVKCH
GSLSAPRAMLSCSRSGKKDTCALTCPSRARFLPESENGFMVTCGTPSPRSSQSRSGNNTS
THHCLETAVLSVKQRASFKIKDAKCRLHLRNKGKLEEAGRLPASGGTPCSDCHVTFIHLK
CDSSRKGKGRRARTPPGKEVTRLTLELEAEVKAEETTAGCGLPCLRQRMERRLKGSLKML
RKSINQDRFLLRLAGLDYELAHKPSPAGERVEQAETCVPGQHRTGVKCVSCPQGTYYHGQ
TEQCVPCPPGTFQEREGQLSCDLCPGSDAHGPLGATNITTCAGQCPPGQYSGDGFKPCQQ
CPRGTYQPESGRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNTSIHRCIRCALG
SYQPEFRQNFCTRCPGNTSTDFDGSTSVTQCKNRQCGGEIGEFTGYIESPNYPGNYPAGV
ECTWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFT
ARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKL
IKAFFEVLAHPQNYFKYTEKHKEMLPRSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences F6SEA3
ENSMODP00000017288 ENSMODP00000017288 XP_007483791.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]