SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017370 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017370
Domain Number 1 Region: 192-328
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.55e-39
Family Cap-Gly domain 0.00000218
Further Details:      
 
Domain Number 2 Region: 71-176
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.2e-33
Family Cap-Gly domain 0.00000925
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017370
Domain Number - Region: 830-917
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000183
Family Myosin rod fragments 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017370   Gene: ENSMODG00000013885   Transcript: ENSMODT00000017690
Sequence length 1054
Comment pep:novel chromosome:BROADO5:2:531082888:531191535:1 gene:ENSMODG00000013885 transcript:ENSMODT00000017690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPSGLKIPNRGGKHSSPVGRTSSGSSSAVATTSSKEGSPLHKQASGPTAATATPAEKP
GPKVAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGSV
GGVRYFECQPLQGIFTRPSKLTRQPTTEGSGSDAHSVESLTAQNLSLHSGTATPPLSTRV
IPLRESVLNSSMKTGNESGSNLSDSGSVKKGDKDLRLGDRVLVGGTKTGVVRYVGETDFA
KGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKKSKRM
AMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEK
QQHIEQLLAERDLERAEVAKATSHICEVEKEIAILKAQHEQYVSEAESSLQRARALVESV
QKEKVDLLNQLEEEKRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLFEKAQA
EKLLRELEDNRMTTVAEKSKILQLEEELSLRRGEIEELQQCLRQAGPSDPSDTSPSSEAL
RLREQLLSASKEHQKESGLLKDKYEKALKAYQHEVERLKATNEKYAQEIVDLKQKVQQAT
SENMGLMDNWKSKLDTLASDHQKSLEDLKATLNSGPNTQHKEIVELKAVMESIKMEHQLE
LGNLRAKHDIETAVLAKEKESLLGKLEQARDELEEVRHHWKAQLEARSNQHLLELQEVKD
QCRDAELRARELGKLDGECKEQAQAIDFLKEQISLAEKKMLDYEALQRTEAQSKQEIQRL
QEKLLVAENKLQAMESLCSSQHSDVIETNDISEEKIRMKQTMEDLQDKLSKRDKEVASLV
SQTEMLKAQVSALEGKCKLGDKKADALLKEKKRLEAELEAVSRKTHDASGQLVLISQELL
KKERSLNELRALLLEANRHSPGPERDLSREVHKAEWRLKEQKLKDDIRGLREKLVVLDKE
RSASDQRRYSLIDPSSESEVLRLQHRLVSTEDVLRSALEQGQQMEKLMEAMRSSPEKSQV
SPLGQTPDGLSGEQQTLTRPPVHFADGFPQNDWS
Download sequence
Identical sequences F6VT30
ENSMODP00000017370 ENSMODP00000017370 XP_001379664.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]