SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017467 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017467
Domain Number 1 Region: 47-512
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.89e-123
Family L-arabinose binding protein-like 0.00000000868
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017467
Domain Number - Region: 514-562
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0158
Family TNF receptor-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017467   Gene: ENSMODG00000013970   Transcript: ENSMODT00000017793
Sequence length 914
Comment pep:novel chromosome:BROADO5:2:272295404:272598958:-1 gene:ENSMODG00000013970 transcript:ENSMODT00000017793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRKSRGCWCLQRLPFLLFLSLCFFWVAPSLGKPRGQGHPHMNSIRIDGDITLGGLFPVH
GRGSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQ
SLTFVQALIEKDGTEVRCVNGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQIS
YASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAF
IQKSREDGGVCIAQSVKIPREPKPGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAAR
KANQTGHFIWMGSDSWGSKISPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRR
NIWFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSSYEQEGKVQFVIDAVYAMGH
ALHAMHRDLCPGRVGLCPRMDPVDGVELLKYIRNVNFSGIAGTPVTFNENGDAPGRYDIY
QYQIRNATPEYRVIGSWTDHLHLKMERIHWPGGGQQLPSSICSLPCQPGERKKTVKGIPC
CWHCEPCTGYQFQQDRYTCKTCPYDMRPTENRTGCQPIPIIKLEWGSPWAVLPLFLAVVG
IAATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRVF
LGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWF
VVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVP
ETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLY
MPKVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGSFRPNGEARSELCDNLEAQAL
ATKQTYVTYTNHAI
Download sequence
Identical sequences F6R6X5
XP_001378002.1.35504 XP_007483753.1.35504 XP_007483754.1.35504 ENSMODP00000017467 ENSMODP00000017467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]