SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017487 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000017487
Domain Number - Region: 485-591
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 356-451
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0217
Family Myosin rod fragments 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017487   Gene: ENSMODG00000013985   Transcript: ENSMODT00000017813
Sequence length 639
Comment pep:novel chromosome:BROADO5:4:362227468:362297381:1 gene:ENSMODG00000013985 transcript:ENSMODT00000017813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVA
FTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLK
NFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPE
QQMLQRQEREAEEAAKGLSDVDSSMLLHHNGGIPTSKKLSTTLPELEYREKGKEKEKDAK
KHNLGINNNILQPVDSKIQEIEYMENHINSKRLNNDLVGSTENLLKEDSCTASSKNYKNA
SGVVNSSPRSHSTTNGSIPSSSSKNEKKQKCTSKSPSVHKDLMENCIPNNQLSKPDALVR
LEQDIKKLKADLQASRQVEQELRSQISSLTSTERGIRSEIGQLRQENELLQNKLHNAVQM
KQKDKQTISQLEKKLKAEQEARSFVEKQLMEEKKRKKLEEATAARAVAFAAATRGECTET
LRNRIRELETECKKLTIDMKLKEDQIRELEIKVQELRKYKENEKDTEVLMSALSAMQDKT
QHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIIQKDQEIKDLKQKIAEVMAVMPSIT
YTAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQPLKK
Download sequence
Identical sequences F6QKZ9
ENSMODP00000017487 ENSMODP00000017487 XP_007491385.1.35504 XP_020838800.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]