SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017504 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017504
Domain Number 1 Region: 2092-2391
Classification Level Classification E-value
Superfamily BEACH domain 1.23e-122
Family BEACH domain 0.0000000105
Further Details:      
 
Domain Number 2 Region: 2509-2762
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.33e-31
Family WD40-repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 1989-2089
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-24
Family PreBEACH PH-like domain 0.0075
Further Details:      
 
Domain Number 4 Region: 451-501,547-641,1078-1295
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000432
Family Armadillo repeat 0.096
Further Details:      
 
Domain Number 5 Region: 650-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000373
Family Laminin G-like module 0.074
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017504
Domain Number - Region: 99-318,454-482,526-600
Classification Level Classification E-value
Superfamily ARM repeat 0.000101
Family Clathrin adaptor core protein 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017504   Gene: ENSMODG00000013995   Transcript: ENSMODT00000017830
Sequence length 2800
Comment pep:novel chromosome:BROADO5:6:196983112:197085631:-1 gene:ENSMODG00000013995 transcript:ENSMODT00000017830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQAKLKPSWAVGRQASSMNKEVSLLTFSARCHLEYYVQKDLSYLHQWLEAFVTSFEKVI
AVHSLEPRRPEEATSEIPLLPQNVLQVLGQQLGLCAECLGEANLTQALLLLKFFIIICRN
LENVQADTTPIFIPPVITMLGACNTELKKGAQAPDRPCKSQLESVALHALHLLECLFDPY
QTWRRQLSGEVVSPKEKSKYKFAPAALPKDFSTFFQESLQDADLLPPILQLRFIHLFGAI
ITGGKENALAAVTPSSVEGLLGVLRSWGGPSQDPQLLQLALQGLVGAVHLLHASGAPRRG
PELRALLEGYFRVLNTDRPPATTQENSPTPSPTGGEEGLIMLRVSMLDAIPKMLDCADRP
VLQAVFLSNNCFEHITRLIQNSKLYLRARSPVASEGGNDLTTQLLTELDIQKQAPTSPCF
PGTSLPVCSQELHAQQELCRNSGITIQVLDRDTDAIAVHAVRVLTSIMSNSPSAKEVFKE
RIGYSHLFEVLKSQGPPTKRLLQELLNMAVEGDHNACPPPPIRNEQPLLILAQWLPVLPS
SDLQVYLAERLRLLCDGGPLSQTTCVKAGLVNYLLEALGTEPALKRQAAEQLLELLQALG
GVSLRPEELRCLFRLLWTESGKGAHPYTASVIRALSGMARQKGPERALRYFDLTPSMAGI
MVPSIQRWPGAAFSFHAWLCLHQEPPIPSLQRGGCSIFHPAGPPQLKRKQLYSFFTPSGT
GFEAFFTSAGMLVVAVCTRKEYMTVSLPEFPFNDSAWHSVAIIHVPGRRPFSQNLLYVYA
DGQLLKTAPLRCPSLNESFSSCCIGLAGNRTTTTTTGPPIFPGPAYPQQLPFSAHPSLSR
SQSFPASMSGSSWGPSANVAGSSREGGVSTTLAGSQDTEWGSPTSLEGQLGSVVIFHEVL
QPAHIRTLFTLGPNETSPFKPEGELQELSNKMLLHYTPQACKNKICLDLSPSHGLDGRLT
GHKVVNWDVKDVVNCVGGMGVLLPLLEQVGSQPQEAEGQAETHDLVGPELTSSHNAQGLL
IPLGKSSEGRVERNGVAAFLLMMKNFLRGHLVNQESLMQCHGPAIIGALLQKVPSHCMDM
NVLMAAQMLMEQVASEGNGPLLHLLYQHLLFNFNLWSHSDFAVRLGHIQYLSSIIKEHRQ
KVRKKYGVQYILDSVRAHYSPQRERPLAEDDLRTVQTSLFSLVKEFLARSFSPEEMQAVL
NYLAGSSDEGQICGVLDMLLNLLRSSPVQEPLCTFLLEPNNVEVLFALLVHRSFSDQLRD
KVFKILNKLLKSDRVPERSKHRLKLKDCGLQGLIACLPDGPVSSHLCRGLSEQVLGTDCP
NLKDLVAVVYLSHRAQLSVRLDMCRKLFHLIYGQPDMVRQLARQVGWQDILTRLYVREAP
AASSPNPPEPALAELSSDVFLPLTCEASLGSSESFPETEVSPPDSVRRSSSTVAPSDPPS
LEATYQPLSPFCSPFDLGPELASTGSGATVGSGENLTPVSLPGTPSPLEGGRPFPPLRGR
HSSSLSNVLDETSFQEPSLGDDTSNTSNPQQAPEEELCNLLTNILFSVTWRGVEGDDEAA
WRERGQVFSVLTKLGAAGELVRPPDEIKRSLLEMMLESALTDLQEALPVALPSLTQHVLK
LLRLLQDFLHSEGHGNQALWSEKLFEGVSSLLDHLGVWQHLTNGAADLREMAQIGLRLVL
GYMLLEDTQLHALAYVKLHGLLQTAVPPRREEACYLLAKLEAPLARALEAESERCSWLVP
LVRTLLDRAYTALGLQWGLPSLPPTNGSPTFYEDFQAFCTSPEWRLFIDKQVQPAMSQFE
MDTYARSHDHMSSFWNSCYDALMSSSLRRDRERTESRHLFQELVLEPVMKRGRSEGKRYS
SVQKQLSSQHAIALLHWKALGRLLTAPRSAWAQRNPPPPRWKLSSAETYSRMRLKLVPNY
HFDQHSEASALRDNLGATDHLIPSTEDSLPLTVAKEAKVSTLQEDQLGEEELTVLDTVTE
SSEPGGQQEKLVLWEDCQLITIVAVIPGRLEVTTQHLYFYDCSVEKEETEEGIGYDFRRP
LSQLREVHLRRYNLRRSALELFFTDQANYFLNFPRKVRNKVYSCILGLRPPSQGYYGSHS
PQEMLRASGLTQKWVHREISNFEYLMQLNTIAGRTYNDLSQYPVFPWILQDYTSETLDLN
DPSVFRDLSKPIGVVNSKHAQLVREKYESFEDPTGTTDKFHYGTHYSNAAGVMHYLIRME
PFTSLHIQLQSGRFDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGFDL
GSLQLTNERVGDVVLPRWARSREDFIHQHRKALESEHVSAHLHEWIDLIFGCKQRGPAAV
EALNVFYYCTYEGAVDLDAVADETERKALEGIISNFGQTPCQLLKEPHPPRLSAEDAARR
LARLDTYSPNLFQNLDQLKAFFVEGISDGVPLVLAVVPHRQAHSFMTQGSPDLLVTVSAN
GLLGTHNWLPYDRNINNYFTFSKDPTVSNAKTQRLLSGPWPPGRGVSGRALAVAPDGKLL
FSGGHWDGSLRVTSLPRGKLLSQLSHHIDIVTCLALDLCGLYLISGSRDTTCMVWQVLQQ
GGLSAGLAPKPVQVLYGHEAEVTCVAISTELDMAVSGSKDGTVIIHTIRRGQFVASLQPL
GGAVPGPVAHLALGPEGQIVVQSLAQERPGAQTSYFLHLYSVNGRLLASQKLEEQSTALA
LTDAFVLLGTAQCNLHILHLHSLLPAVPSMSMKVPIHSVAVTKERSHILVGLEDGKLIVV
GAGQPSEVRSGQFARRLWRSTRRISQVSSGETEYNPPEAK
Download sequence
Identical sequences F6VRA6
ENSMODP00000017504 ENSMODP00000017504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]