SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017590 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017590
Domain Number 1 Region: 4-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.22e-91
Family Motor proteins 0.00000406
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017590
Domain Number - Region: 302-352
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 0.0549
Family Apolipoprotein A-II 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017590   Gene: ENSMODG00000014066   Transcript: ENSMODT00000017916
Sequence length 721
Comment pep:novel chromosome:BROADO5:6:196650944:196710381:1 gene:ENSMODG00000014066 transcript:ENSMODT00000017916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLGTIMCYGQTGAGKTYTMTGTTENYKHRGILPRALQQVFRMIEERPTHSITVRVSYME
IYNETLFDLLSTLPYVCNTDTPMIIAESPQGIFVKGLSVHMAGREEDAFSLLFEGETNRI
IASHTMNKNSSRSHCIFTIYIEAHSRSLSDEKYITSKINLVDLAGSERLGKTGSEGQILK
EATYINKSLSFLEQAIIALGDRKREHIPFRQCKLTHALKDSLGGNCNMVIVANIYGDANQ
LEETLSSLRFACRMKLITTEPAINEKYDAERMVKNLEKQLVLLKQELAIHDSLANRSMVT
YDPMDEVQIAEINSQVRRYLDGTLEEIDIINLRQIQEVFNQFKIILSQQEQEVESNLRRK
YTMIDKNDFATISAAQKAGLIDVEGNMVGDTDGQGFGLGLAPFTSKVMKKTKVKKPFKDF
GALLKKETPGSPGSVKDGESVSTSKTQLLSSKEVDVKDVPSRDREASSSEPIQSESPKEE
TRPTRPSTPPPKPSAFEEFKNERGSEINRIFKQNKTILNDRRKKASEAAQRINSIKREID
STKEALNVQKTFREEQGEYENKGLMIIDEEEFLLILKLKELKKQYRGEYQDLRDLKAEIQ
YCQHLVDQCRQRLLSEFDIWYNESFLVSEEVQSPPKTKGGSMRLGTIPLSKLTSLAEDDE
DKFGQTQLSNLTDCPDSVAFYNAKMKLDQKQNYSKTMASFQPKKSVPIVLKEKSPSDYNL
P
Download sequence
Identical sequences F6TSW9
ENSMODP00000017590 ENSMODP00000017590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]