SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017670 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017670
Domain Number 1 Region: 275-664
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-108
Family Motor proteins 0.000000203
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017670
Domain Number - Region: 144-255
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017670   Gene: ENSMODG00000014132   Transcript: ENSMODT00000017998
Sequence length 675
Comment pep:novel chromosome:BROADO5:2:271054067:271057960:1 gene:ENSMODG00000014132 transcript:ENSMODT00000017998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCFLQKLSRMEKDNMELKMPPDKASSSQLPVLGLSAKRGLDKENVPEPKKKRARGPGT
AATIAISHPRVPTMATMPRVKKQEAAQKATLKSGPWHTTAANTGIKSRKPISAVSAPKPA
VDPTTTRKGPSKRPAWDVKGQLCDLRKEFSACQEQTEVLTRENRELRNQLGEAEQHTKTL
NAENKALKAENKALSGELSEVQVQAKQDQLELVKLGARVLELEELLHNQEGLIQSLQEEQ
LRLQAERRDLVIQLEVQTTQLQESTAALAKSQAEIITQAALLAERTEHLHGLEMERRYLH
NQLQELKGNIRVFCRVRPALPGELEPPSGLIVFPPGPNGASDPPTRLSLTRPSDDRCSII
GGLPGPPVRYDFSFDRVFLPGSRQNEVFEEVSLLVQSALDGYPVCIFAYGQTGSGKTFTM
EGGPGGDPQVEGLIPRAVRHLFSVAKKLQGQGWSYTFVASYVEIYNETIRDLLASVGGAR
KCQGGECEIRLAGPGSKELIVTNARYVPVTCEEEVESLLHLARQNRAVARTTQNEQSSRS
HSVFQLQISGKHMGQNLHCAAPLSLVDLAGSERLDPGLSAGPAERERLKETQAINSSLST
LGLVIMALSNKEPHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENFSESLNSLRFAS
KVNQCIIGTARSNKK
Download sequence
Identical sequences F6XKS9
ENSMODP00000017670 ENSMODP00000017670 13616.ENSMODP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]