SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017723 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017723
Domain Number 1 Region: 96-233
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.94e-41
Family Cap-Gly domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 8-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.89e-26
Family Ubiquitin-related 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017723   Gene: ENSMODG00000014175   Transcript: ENSMODT00000018051
Sequence length 246
Comment pep:novel chromosome:BROADO5:4:384156161:384165146:1 gene:ENSMODG00000014175 transcript:ENSMODT00000018051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSGVSSPTVTVFISSSLNSFRSEKRYNRGLTLAEFKCKLELVVGSPASCMDLELYGVD
DSFCMKLDQDDALLGSYPVDDGCRIHVIDRSGARLGEFEDLSQVEKYEISQSAYESRPDS
VRSFLKRSKMGKFNEEEQKRREAEAAQRLAEEEAHAQAIVVGSRCQVQAAGQPTKRGTVM
YVGLTDFKPGYWVGVRYDEPLGKHDGSVNGKRYFECQDKYGAFVKPHTVTVGDFPEEDYG
LDDDEM
Download sequence
Identical sequences F6U7B4
ENSMODP00000017723 XP_001370708.1.35504 ENSMODP00000017723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]