SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017731 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000017731
Domain Number - Region: 696-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 664-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 728-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00187
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 565-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 762-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0305
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 632-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0457
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017731   Gene: ENSMODG00000014182   Transcript: ENSMODT00000018059
Sequence length 788
Comment pep:novel chromosome:BROADO5:8:311097064:311109627:-1 gene:ENSMODG00000014182 transcript:ENSMODT00000018059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALRRRKRQSLREHPPTLAFQTLSPADLDAFSYFFPEDHGAAPHAALVPSWPTPSGLTEAR
VVAVCRQTLANSSIGTLCSGFLGEHIDGAVDMCVRDVLLKDDLSWAEAGLALLENECEKR
LLEEGKYNPGSNEQFLEDILLAFRCPNLCSGHGRCMEWGCACLQGFGSYDCGVPSGKSGS
WKTSGGKQLLAFETLPQRNGVSQWVKGSSLVTVPGEEGAGTKMRMVPLPWGASLYHSVHQ
RSVEAETQKVLGRFSSATDAASGQHGWHFSPRTHGWHLLSPFNYTVTSIKTPRKHGPSWE
SWLCSGSVCVVAQETLNFSEGAAGEGCPAPSSLDWEISGFKWSQAGAGSPRPSSTWLQGE
ALTVWRTFGHHSCPPKTPVGPHRPPTGPRRPWTSTQGLPVPLAGQLLCGILGVRRRGGFE
ASARAAFLWGALGGISRAHTTPPPRARLCGVLDAASTHVAPSPASPVAVSSLSSGVAVKA
EGPPVMASSSPEPGRSLRPSPAPRTSGSLRRDVLGPGRSSASSAPPTGDPCAPPPCFQGV
PCAPALDGGPRCGRCPPGYYGDGASCQALCRPSCKNGGKCVRPGVCQCLPGLGGISCEEE
SPSRCPSSLPRCVPAEAALASKALSSLNAALCRPSCKNGGKCVRPGVCQCLPGLGGISCE
EASCEPACLNGGLCHKPNACLCPAGFFGATCQNAICQPPCHNGGHCLRDNVCSCPEGYAG
WRCQKSVCEPACMNGGRCVRPGVCSCPSGWRGRRCSSPICLPKCQNGGHCLGPGVCRCPS
SWGGVHCQ
Download sequence
Identical sequences F6U6R7
ENSMODP00000017731 13616.ENSMODP00000017731 ENSMODP00000017731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]