SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017812 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017812
Domain Number 1 Region: 322-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.49e-22
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 92-127
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000408
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017812
Domain Number - Region: 206-320
Classification Level Classification E-value
Superfamily Prefoldin 0.000191
Family Prefoldin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017812   Gene: ENSMODG00000014253   Transcript: ENSMODT00000018141
Sequence length 405
Comment pep:novel chromosome:BROADO5:2:195423386:195431655:1 gene:ENSMODG00000014253 transcript:ENSMODT00000018141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYDELTPTSWGIKGPGRQVDLTQLDHRTNPPSITHTTMPYNCCLPNISCHTSCASRPCL
PPSCHGCTLPGACDIPANVGNCGWFCEGAFNGNEKETMQFLNDRLANYLEKVRQLEVENA
ELESRIQEWCQQHVPYVCPDYQSYFRTIEELQQKILCTKSENSRLVICIDNAKLASDDFR
TKYETELSLRQLVEADINSLRRILDNLTLCKSDLEAQVESLREELVCLKKNHEEEVNSLR
CQLGDRLNVEVDAAPTVDLNRILNETRAEYEAMIENNRRDVEEWYNTQSEELNKQVVSSS
EQLQNCQAEIIDLRRTVNALEIELQAQHNLRDSLENTLTESEARYSSQLSQIQCMVSNVE
SQLAEIRGDLDRQNQEYQVLLDVRSRLECEISTYRNLLECEDCKC
Download sequence
Identical sequences F6XJS2
ENSMODP00000017812 ENSMODP00000017812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]