SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017863 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017863
Domain Number 1 Region: 146-733
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6e-195
Family Myeloperoxidase-like 0.0000000000446
Further Details:      
 
Domain Number 2 Region: 740-799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000598
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 793-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017863   Gene: ENSMODG00000014296   Transcript: ENSMODT00000018192
Sequence length 872
Comment pep:novel chromosome:BROADO5:1:543005227:543192421:-1 gene:ENSMODG00000014296 transcript:ENSMODT00000018192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLVVLGISMVVACTEVLFSFIQKSTNFFWGGTEKCHVTSIVEKSIHMVDNALYNTMKR
NLKKRELNSPDQLFSFSKLPERTSRDVSRAAEIMETSIQAVKKKVSLQHKKSWHPTDVLS
ADLLSTIVKVSGCLPYMLPPKCPNTCLANKYRLITGACNNRDNPRWGAANTALARWLPPD
YEDGVSQPKGWNPNFLYNEFPLPLVREVTRKIIHASNEAVTEDDQHTDLLMVWGQYIAHD
IAFTPQSTSRATFWEGTDCQRTCESQNPCYPIQFPANETLSMGLECLPFYRSSPACGTGD
QGSLFGNLSKSNPRQQMNTLTSFLDASTVYSSSTAIENKLRNLTSQEGLLQVNTLYEDAG
REYLPFVTQVPSPCAQALNTEKSERIECFLAGDSRASEVISLAAMHTLWLREHNRLAKNL
KMLNTHWSSETIYQEARKIVGALHQVITLRDYIPKILGPMAFEQYVGPYKGYDSTVNPTI
SNIFSTAAFRFAHATIHPVVRRLDERFQDHPDHPKLFLHEVFFSPWRLIKEGGLDPVIRG
LLASPAKLQIQDQIMNEELTEKLFVLSNNGTLDLASLDLQRGRDHGLPGYNDWREFCDLQ
RLETETELYTAITNRSIVEKIIELYKHPNNIDVWLGGLAENLLPNARTGPLFACIIGRQM
KALREGDRFWWENKHVFTEAQRHELEKHSLSRLICDNTGLTTVPADAFQLGSFPTDFKSC
EDIPGINLEAWREIFHQEGTCSFPEKVDDGDFASCSESGKLIVIYSCHHGYQLQGQEQLT
CTHRGWDSPPPLCKDINECEDQMNPPCHSSAKCKNIKGSYQCVCTDPYELGEDERTCIDS
GRLPRGSLVSIILGAIMVCGLTVLTWIVICRW
Download sequence
Identical sequences F6WJN9
ENSMODP00000017863 ENSMODP00000017863 13616.ENSMODP00000017863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]