SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017926 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017926
Domain Number 1 Region: 41-95
Classification Level Classification E-value
Superfamily DEATH domain 0.0000259
Family Caspase recruitment domain, CARD 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017926   Gene: ENSMODG00000014342   Transcript: ENSMODT00000018256
Sequence length 183
Comment pep:novel chromosome:BROADO5:6:194466920:194513129:-1 gene:ENSMODG00000014342 transcript:ENSMODT00000018256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQTYCDRLVQDTPFLTSNGRLNEQQVDKIILQLNRFYPQILTNKEAEKFRNPKTSLRI
RLSDLLTHLQRKGERDCQEFYRALYINAQHLYGSLPSRKAMKTSDSTELDLDKEKYNLND
RGPMFFLACFSVAAGLAFLIYYCSPDPRVFRGARRVIGFSPIIIGKHVSHYLLAYLEKSF
REP
Download sequence
Identical sequences F6ULG7
ENSMODP00000017926 ENSMODP00000017926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]