SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017939 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017939
Domain Number 1 Region: 44-138
Classification Level Classification E-value
Superfamily PCD-like 5.23e-35
Family PCD-like 0.00000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017939   Gene: ENSMODG00000014351   Transcript: ENSMODT00000018269
Sequence length 141
Comment pep:novel chromosome:BROADO5:1:301702110:301753696:-1 gene:ENSMODG00000014351 transcript:ENSMODT00000018269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAGSVAAVVLRFRGRLIPALLGSPWVAPGKSRSLSVMSAESHWLTTEERNQVIHDLKA
SGWSELNERDAIYKEFCFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLISHDC
GGLTKRDVKLAQFIEKAAASV
Download sequence
Identical sequences F6U5L4
XP_007473425.1.35504 ENSMODP00000017939 ENSMODP00000017939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]