SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017979 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000017979
Domain Number - Region: 30-92
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017979   Gene: ENSMODG00000014387   Transcript: ENSMODT00000018310
Sequence length 786
Comment pep:novel chromosome:BROADO5:1:708216084:708249832:-1 gene:ENSMODG00000014387 transcript:ENSMODT00000018310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADANSPIKLTGVAAAAAEGKGGGCCSELSAELIRSLTELQELEAVYERLCSEEKVVEEE
LDALLEQQSTIESKMITLQRMGPNLQLIEGDAKQLAGMITFTCSLAENVSSKVRQLDLAK
NRLYQAIQRADDILDLKFCMDGVQTALRNEDYEQAAAHIHRYLSLDKSVIELSRQGKEGS
MIDANLKLLQEAEQHLKAVVTEKFDIATKEGDLPQVERFFKIFPLLGLHEEGLSKFSEYL
CKQVANKAEENLLLVLGTDMSDRRAAVIFADTLTLLFEGIARIVETHQPIVETYYGPGRL
YTLIKHLQLECDQQVEKVVDKFIKQRDYHRQFQLVQNSMMRSSAAEKIEPRELDPILTEV
TLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNHCLLSCTMQELIGY
YITMEEYFMRETVNKAVALDTYEKGQLTSSMVDDVFYIVKKCIGRALSSSSIDCLCAMIN
LSTTELESDFREVLCNKLRMGFPATTFQDFQRGVTSAVNIMHSSLQQGKFDTKGIESTDE
AKLSFLVTLNNVEVCSENISTLKTTLESDCTKLFSQGIGGEQAQAKFDSCLSDLAAVSNK
FRDLLQEGLTELNSTAIKPQVKPWINIFLSVSHNIEEEEFNDYEANDPWVQQFILNLEQQ
MAEFKAGLSPVIYDSLTSLMTSLIAIELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVT
TWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRSED
IKRLRL
Download sequence
Identical sequences F6T7R4
13616.ENSMODP00000017979 ENSMODP00000017979 XP_007477580.1.35504 ENSMODP00000017979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]