SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017996 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017996
Domain Number 1 Region: 289-366
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.74e-23
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 59-94
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000502
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017996
Domain Number - Region: 172-287
Classification Level Classification E-value
Superfamily Prefoldin 0.00175
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017996   Gene: ENSMODG00000014396   Transcript: ENSMODT00000018327
Sequence length 401
Comment pep:novel chromosome:BROADO5:2:195294879:195309626:1 gene:ENSMODG00000014396 transcript:ENSMODT00000018327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRPEACMPYLCQPMGYVPSIYRPSSCLPKTYLPSSCRPSSCRPPCSLPGSWFGDGVFNGN
EKETMQFLNDRLANYLEKVRQLEQENANLENKIQEACQSQGPTICPDYQSYFRTIEELQQ
KVLCTKAENARMVVQIDNAKLAADDFRTKYETEVSLRQLVEADINGLRRILDELTLCKAD
LEAQVESLKEELLCLKKNHEEEVNALRCQLGDRLNIAVDAAPPVDLNRMLEEMRCQYETV
VENNRRDVEEWFNAQMEELNQQVTTSSEQLQSYQSDIIDLRRAINALEIELQAQHSMRDS
LENTLNETEARYSSQLTQMQCMISNVESQLANIRCDLERQNQEYKILLDVKARLECEIAT
YHSLLESEDCKLPCNPCTTPSCTPCMPRTVCVPHSVCGPCT
Download sequence
Identical sequences F6SRI1
ENSMODP00000017996 13616.ENSMODP00000017996 ENSMODP00000017996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]