SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018153 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018153
Domain Number 1 Region: 322-400
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.55e-24
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 92-127
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000012
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018153
Domain Number - Region: 205-320
Classification Level Classification E-value
Superfamily Prefoldin 0.000471
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018153   Gene: ENSMODG00000014529   Transcript: ENSMODT00000018485
Sequence length 462
Comment pep:novel chromosome:BROADO5:2:195246373:195252033:1 gene:ENSMODG00000014529 transcript:ENSMODT00000018485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSQICTPTFSTGSFKGLCGTSGGFSRISSVRSLGSCRVPSLSCSGGSASSLKLGSCGLG
SYLPNTSYLSNGYSTSGFGGSFIRFGEGVFNGNEKETMQFLNDRLANYLEKVRMLERENA
ELEKKIQEWYGSQILLVYPDYQSYFKTIEDLQQKILLTKAENARLVLQIDNAKLAADDFR
TKYETELSLRQLVEADINGLRKILDELTLCKADLEMQLESLKEELLCLKKNHEEEVNILR
SQLGDRLNVEVDAAPPVDLNKILNDMRCQYEALVENNRRDVENWFTTQTEELNQQVVSSS
EQLQCCQTEIIELKRNVNALEIELQTQHSLRNSLESTLAETEARYCSQLSQLQCLIGNVE
AQLAEIRCDLERQNQEYQVLLDVKARLESEISTYRRLLEGEDCKLPAHPCATECKPMVRG
SCPPSVSCTPSSQISTQIRTITEEIKDGRVVSSREHVQHRPL
Download sequence
Identical sequences F7ER43
XP_001368059.1.35504 ENSMODP00000018153 ENSMODP00000018153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]