SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018163 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018163
Domain Number 1 Region: 1710-1877
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.39e-32
Family Ankyrin repeat 0.00000342
Further Details:      
 
Domain Number 2 Region: 496-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000008
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 380-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 853-983
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 674-832
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 6 Region: 113-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000587
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 7 Region: 1065-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 228-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 1027-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 606-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 150-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000857
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 12 Region: 1116-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000901
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 13 Region: 1271-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 266-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000301
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 15 Region: 1190-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000399
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 1404-1437
Classification Level Classification E-value
Superfamily Notch domain 0.0000000654
Family Notch domain 0.0035
Further Details:      
 
Domain Number 17 Region: 303-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 345-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 1325-1357
Classification Level Classification E-value
Superfamily Notch domain 0.000000366
Family Notch domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1365-1397
Classification Level Classification E-value
Superfamily Notch domain 0.000000562
Family Notch domain 0.0048
Further Details:      
 
Domain Number 21 Region: 191-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 22 Region: 73-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 23 Region: 995-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000679
Family EGF-type module 0.064
Further Details:      
 
Domain Number 24 Region: 1232-1272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.029
Further Details:      
 
Domain Number 25 Region: 35-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000041
Family EGF-type module 0.053
Further Details:      
 
Domain Number 26 Region: 1148-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000982
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018163
Domain Number - Region: 828-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00567
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018163   Gene: ENSMODG00000014540   Transcript: ENSMODT00000018494
Sequence length 1936
Comment pep:novel chromosome:BROADO5:3:477582725:477612416:-1 gene:ENSMODG00000014540 transcript:ENSMODT00000018494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGVRGQAVRLLVNCLLGTTLLALSGAVAAALQCLDGGSPCENGGRCALLSNGEAACLC
RPGLMGDRCQFEDPCHHGPCTNGGTCKSSLLQGTVQYSCICPRGLRGQDCSLIDPCANNP
CANGGRCSSNHNRYNCTCPPGYQGRTCRSDVDECRVGTVCQHGGTCLNVPGSFRCQCPAG
YAGPLCESPSAPCAPSQCRNGGTCHQTGEFTYDCACLPGFEGHDCEVNVDDCPKHRCLNG
ATCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTHGGHSCVCVNGWTG
ESCSENIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDT
NPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHFGKCVNTQGSFQCQCGRGYTGPRC
ETDINECLSGPCHNQATCLDRIGQFTCICMAGFTGTFCEVDINECQSSPCVNGGHCRDRV
NGFSCTCPSGFSGTMCQLDVDECASTPCHNGAKCVDQPDGYECRCAEGFEGPLCENNVDD
CSPDPCHHGHCVDGIASFSCACAPGYTGSRCESQLDECHSQPCQHGAKCLDLVNKYLCYC
PPGTSGVNCEINHDDCASNPCDYGVCQDGINRYDCICQPGFTGPLCNVEINECSSNPCGE
GGSCVDGENGFRCICLPGFLPPLCHAQRHPCASNPCTHGTCHDDPSGHRCECEQGWTGPS
CDQNQNECESNPCQAGGTCTDYVNGFRCTCPDGLQGLFLCVLVPLCPPGPHCELDIDECE
GAQCPRPMSPVPPSPPDPCLNGGSCRDGVGSFFCVCLPGFSGPRCALDIDECQSSPCGPG
TCSDHVASFTCACPAGYGGLRCERDLPDCSESSCFNGGTCVDGVNAFTCLCRPGFTGPHC
QREVGACHSRPCQHGGTCIDEHRGYRCACLPGYTGAQCQMLVDWCSRAPCQNRGRCTQAG
PAFSCHCPPGWSGHFCDIPSLSCRAAAAKKGVRPQQLCQAGGRCLDAGGTHHCLCPASHT
GSYCEQEVDYCSVQPCRHGGTCRGYVGGYVCECPIGYEGNNCEAEVDECESQPCQHGGSC
IDLVGRYLCSCPPGTLGVLCEINEDDCAVAPGGEQGSHCLHNGTCVDQVGGYRCTCPPGY
TGAHCEGDLNECSPGTCHAPHTRDCLQDAFGGFHCLCHPGYTGRRCQTVISPCESQPCQH
GGQCQPSPNNALAYTCHCPPPFWGPSCERVARSCRDLPCANGGLCQLTALGPRCTCPPGL
AGPSCHLRTNTSCLGIPCRHGGTCRVLAQAPFFRCLCPPGWEGAHCEARVHGALPPLLSP
PEEPQCPRASCRDKRGDKYCDRECNSPACQWDGGDCSLSVDDPWHQCQALQCWRLFNNSH
CDPACNTPACLYDNFDCHSQERGCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCAGA
VPELLAKGVLVLTVLLPPEELLRSSADFLQRLSAILRTALRFRRDAHGNLMIYPYHRPGG
RPRRELAPEIIGSVVMLEIDNRLCLQTPESNHCFPDAQSAADYLGALSAVERLDFPYPLR
AVRGEPLEPPESSLRLLPLLVVGAVILVTLGLGVLVARRKREHSTLWFPEGFSLNKDSAG
ANKGRREPVGQDALGMKNMTKGESLMGEPSEDWMDTESPEAKRLKVEEPGTGAEDPVDCR
QWTQHHLVAADIRVPPAMALTPPQGDLDADGMDVNVRGPDGFTPLMLASFCGGALEPVLV
DAEEAEDTPANIISDLICQGAQLGAQTDRTGETALHLAARYARADAAKRLLDAGADTNAQ
DHTGRTPLHTAVTADAQGVFQILIRNRSTDLDARMVDGSTALILAARLAVEGMVEELIAC
HADVNAVDELGTVGLWIMGEEGSVEMGLREEEGNVRCAFRDLRQSGGEIRSDAIGPSNSL
PTCSFIFSHWDTLEDV
Download sequence
Identical sequences F7E9E2
ENSMODP00000018163 ENSMODP00000018163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]