SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018270 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018270
Domain Number 1 Region: 82-548
Classification Level Classification E-value
Superfamily Cytochrome P450 4.19e-118
Family Cytochrome P450 0.00000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018270   Gene: ENSMODG00000014622   Transcript: ENSMODT00000018603
Sequence length 563
Comment pep:novel chromosome:BROADO5:3:478123178:478168031:1 gene:ENSMODG00000014622 transcript:ENSMODT00000018603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLQEASRKVLIFSFACSSSGTMVPITDQILKVLRLEKTSFRTYAISALLLSLLFIFFRF
LVKVFQICHKFHITCQRLRCFPQPPGRNWLLGHLGMYLPNESGLRDEMKVLDTLRHVVLV
WIGPFLPLVVLVHPDYIKPLLGASAAIAPKDKLFYGFLTPWLGDGLLLSKGEKWSRHRRL
LTPAFHFDILKPYMKIYNQCTDIMHAKWHRLTAGATASLDMFEHVSLLTLDSLQKCVFSY
NSDCQEKNSDYITAIIELSALVVKRQYRIHHHLDFIYYRTADGRRFKKACDIVHRFTTEV
IQERRQALNQQGAEAWLKSKQGKTLDFIDVLLLAQDEDGKQLSDEDIRAEADTFMFEGHD
TTSSGLSWVLFNLARYPEYQDKCREEIQEIMKGRETDEIEWDDLAQMPFITMCIKESLRL
FPPVTLISRRCTEDIKMPDGRVIPKGIICLVSIYGTHYNPSVWPDSKVFNPYRFDPENSQ
QRSPLAFIPFSAGPRNCIGQSFAMSEMKVVVALTLLRFRLSVDRTKKVRRKPELILRTEN
GIWLNVEPLSGQTTATPMAQPQQ
Download sequence
Identical sequences F6YPY9
ENSMODP00000018270 ENSMODP00000018270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]