SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018276 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018276
Domain Number 1 Region: 347-425
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.15e-25
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 117-151
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000837
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018276
Domain Number - Region: 231-345
Classification Level Classification E-value
Superfamily Prefoldin 0.000497
Family Prefoldin 0.0093
Further Details:      
 
Domain Number - Region: 168-260
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.022
Family Myosin rod fragments 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018276   Gene: ENSMODG00000014628   Transcript: ENSMODT00000018609
Sequence length 475
Comment pep:novel chromosome:BROADO5:2:195050738:195058132:1 gene:ENSMODG00000014628 transcript:ENSMODT00000018609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCSRQFTSSSSMKGSCGIGGGSSRISMIGGGSCRAPSAYGGSGFGGMSVTTSRFSSGG
ACGLGGGYGGAFSSSSSFGGGYGSGAGYGSGFGGGYGGGFGGGYGGGFGSMDGLLAGGEK
VTMQNLNDRLAAYLDKVRSLEEANTELEVKIRDWYQKQRPTERKDYSPYYRTIEELKNKI
LTATVENANILLQIDNARLAADDFRTKYETEANLRMSVEADINGLRKVMDELTLSKADLE
MQIENLKEELAYLRKNHEEEMNSLKGQVGGDVNVEMDAAPGVDLTRELTEMREEYEALVE
KNRKDAEAWFFSKTEELNREVTSNSELVQSGKSEISELRRSVQNLEIELQSQLSMKASLE
NSLEETKGRYCLQLSQIQGLISNVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYR
RLLEGEDAHLASQFSSSSQSPKDVSSTSRQVYTKVLDVQDGKVVSSHEQVLRTKN
Download sequence
Identical sequences F6YPS6
XP_003340295.1.35504 ENSMODP00000018276 ENSMODP00000018276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]