SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018302 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018302
Domain Number 1 Region: 316-394
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.27e-26
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 86-120
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000513
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 198-314
Classification Level Classification E-value
Superfamily Prefoldin 0.0000706
Family Prefoldin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018302   Gene: ENSMODG00000014587   Transcript: ENSMODT00000018635
Sequence length 437
Comment pep:novel chromosome:BROADO5:2:194995235:195004461:1 gene:ENSMODG00000014587 transcript:ENSMODT00000018635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTTIRQYTTSSSIKGSSGLGGSSSRASCRAPGSFGSASSSRLVSGGSLGGGYGGSSYS
SGYSFSSGMGGSYGGSFGSVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTDLELKI
RDWYQKQAPGPARDYSAYHQTIEDLKNKILTATVDNANILLQIDNARLAADDFRTKYETE
LALRTSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHDEEMNALRGQVGGE
INVEMDAAPGVDLSRTLSEMRDQYEKIAEKNRKDAEDWFFSKTEELNREVATNSELLQSG
KSEISELRRSVQALEIELQSQLSMKASLEGSLAETESRYCVQLSQIQGLIGSVEEQLAQL
RCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSQYKPKEPVTTRQVRTIVEEV
QDGKVISSREQVHQSTR
Download sequence
Identical sequences F7EQB2
XP_003340291.1.35504 ENSMODP00000018302 ENSMODP00000018302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]