SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018303 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018303
Domain Number 1 Region: 322-400
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.32e-26
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 92-126
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 204-320
Classification Level Classification E-value
Superfamily Prefoldin 0.000000994
Family Prefoldin 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018303
Domain Number - Region: 163-205
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00715
Family Intermediate filament protein, coiled coil region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018303   Gene: ENSMODG00000014647   Transcript: ENSMODT00000018636
Sequence length 452
Comment pep:novel chromosome:BROADO5:2:194983030:194992762:1 gene:ENSMODG00000014647 transcript:ENSMODT00000018636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTTTVRQYSTSGSMKGLCGLGPASSRVSSVRVGGACLAPSLLGAGGCGNMSVTSSRFT
SSLGGGYGGGYSCSLGGGFGASYGVGDALLGGSEKETMQNLNDRLANYLDKVRALEEANT
DLELKIRDWYKKQGPGPARDYSAYFKTIEDLRNKILAATIDNASLVLQIDNARLAADDFR
TKYETELNLRLSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALR
GQVGGDVSVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFTKTEELNREVATNT
EALQSSKTEITELRRTVQNLEIELQSQLSMKASLEGTLAETEARYGAQLAQLQGLISSIE
QQLCELRCDMERQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLASQYSSTLSSGSGRE
AMVTSRQVRTIVEEVQDGKVVSSREQLHRSTH
Download sequence
Identical sequences F7EQA7
XP_003340290.1.35504 ENSMODP00000018303 13616.ENSMODP00000018303 ENSMODP00000018303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]