SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018343 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018343
Domain Number 1 Region: 77-554
Classification Level Classification E-value
Superfamily Cytochrome P450 4.71e-119
Family Cytochrome P450 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018343   Gene: ENSMODG00000014674   Transcript: ENSMODT00000018676
Sequence length 571
Comment pep:novel chromosome:BROADO5:3:476836748:476871336:1 gene:ENSMODG00000014674 transcript:ENSMODT00000018676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNREHQKAIISGELRKTATGACGRPQRRQMVPGSEWLSHQLGLGGLKSGVHSVMILFFL
ALSTWILAQVLFFLNRYYTNIQQLRCFPQPLIWNWFFGHLGLMDFTEESLIRIMEYVTTF
REVFLMWMGPFRPVIVLCHSDYIRPLTSASAHIAPKDNFIYGFLKPWLGDGLLLSGGDKW
SRHRRLLTPAFHFDILKPYVKIFNQCADIMHEKWKRLCAEESTQLDVFDHVSLMTLDTLQ
KCIFSHNSNCQEKPSKYISTILELSVLSTKRSNQFFLYWDSVYFLTSQGRRFTQACHLVH
DFTDAVIKARQKVLAEQGVEAFLKDKGKGKTMDFIDILLLSKDEDGKPLSDKDIRAEADT
FMFEGHDTTASGISWVLYNLAQHQEYQDRCRQEIQELMKGRETEEIEWNDLSQMPFLTMC
IKESLRLHPPVPITFRQCTKDIQLPDSRVIPKGSVCLISIFGTHHNPTVWPNPEVYDPYR
FDTNNPQKMSPLAFMPFSAGPRNCIGQNFAMSEMKVVLALTLLRFRVFPHGNPPRRKSEL
VLRTESGLWLKVEPVQHSSSSEADLREASQN
Download sequence
Identical sequences F7E7L5
ENSMODP00000018343 ENSMODP00000018343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]