SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018403 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018403
Domain Number 1 Region: 40-526
Classification Level Classification E-value
Superfamily Cytochrome P450 1.57e-114
Family Cytochrome P450 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018403   Gene: ENSMODG00000014717   Transcript: ENSMODT00000018736
Sequence length 530
Comment pep:novel chromosome:BROADO5:3:478413906:478437550:-1 gene:ENSMODG00000014717 transcript:ENSMODT00000018736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRQLGLAVLWPGVSSVLLLVFLAISTWVLSRVITSVHRYYINCQRLRCFPQPPLQNWFL
GHLRLIDSNEEGLIRTVQLVNTFREIFLMWMGPFHPLVILCHPDYIRPLTSASANIAPKD
KIFYGFLEPWLGDGLLLSKGDKWSHHRRLLTPAFHFDILKSYVKIFNQSTNIMHEKWKHL
CAGSSTHLDMFEHISLMTLDSLQKCIFSYDSGCQKKSNPYISAILELSSLVACRSKQLLF
FWDSLYYLTSQGRRFSRACHLVHDFSDAVIQARRRILDKHGCDSYFSSKDKGKTMDFIDV
LLLAKDENGNTLSDKDIQAEADTFMFEGHDTTASGISWALYNLAQHQEHQDRCRQEIQEL
LRGRHPEEIEWSNDRPVIPRDDLSQMPFLSMCIKESLRLHPPVVTVTRFCTKDIQLPDGR
IIPKGNRCLINIFGTHHNPSVWTNPEVYDPYRFDSNKSQKMSPLAFIPFSAGPRNCIGQN
FAMSEMKIVLALTLLQFRVFSDGFLPQRKPELILRAEGGLWLRVEPILNS
Download sequence
Identical sequences F6ZD68
ENSMODP00000018403 ENSMODP00000018403 13616.ENSMODP00000018403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]