SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018413 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018413
Domain Number 1 Region: 482-608
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-27
Family Cadherin 0.0027
Further Details:      
 
Domain Number 2 Region: 235-358
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-26
Family Cadherin 0.0057
Further Details:      
 
Domain Number 3 Region: 125-249
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-22
Family Cadherin 0.0053
Further Details:      
 
Domain Number 4 Region: 609-705
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0066
Further Details:      
 
Domain Number 5 Region: 397-486
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-16
Family Cadherin 0.0061
Further Details:      
 
Domain Number 6 Region: 31-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000514
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018413   Gene: ENSMODG00000014727   Transcript: ENSMODT00000018746
Sequence length 1059
Comment pep:novel chromosome:BROADO5:7:163809178:163818545:-1 gene:ENSMODG00000014727 transcript:ENSMODT00000018746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKKLSFPTVPLCSSRLSSLWLVWMLVAGFRTETVNYHIYEEEIPGTVIGVLSAHTRAD
SPGMVPRNFRLMKQFNTSLIRLSEDDGQLTVGENGIDREQLCQQSQQCTLTFDVVSFSQL
IHVEVEVRDINDHSPRFPRSQILVEVSESAAVGTRIPLEVAVDEDVGSNALQSLRLVEPH
SFFRVELQTRADGAKNADLLLLQELDRESQANYSLELVAQDGGDPPRSATAVLSVRVLDA
NDHSPVFPLGSFIEVEVSEDSPEGSLLLDIDATDPDEGPSGDVVFSFGGRTPPEAQLPFH
LDPRSGHLTLTRPLDYEQKETYELDVMAQDQGPGSRVSTCKVIVHILDVNDNAPVITIIP
LVMAVNTASDYSSSFAAPVSASWEEPGGPQSGVALSLIPEGAAQESLVALVSTLDRDSDS
NGQVHCALYGHEHFRLQPAYAGSYLVLTTTPLDRERIPEYNLTLVAQDLGSPPLSTMRPY
TVRVADENDNAPLFARPVYEVSVLENNFPGAYLTTVVARDPDLGRNGKVTYRLLETKEGQ
DRDLVSAYVSVDSDSGVLRARRRFDREALAELEVALEARDGGSPSQWGQTVVRLVVEDQN
DHAPEVIFPLLSNGSALVPLPRGVPPGFLVTRVQARDEDEGPNAELTYSLTHSDGDPGAL
ALHPHTGELSLRRQLSPWPIDPLTLVVTVQDNGRPSLSCTTTLMLVPAPASPPGGNMVLV
PPPPLPPPSREEQAGLQKGRLQRATGRRPDLSTIFIGVLAGGCGLLLVAIVTVASSYQGR
GLIGRKVFFKCSKRSGLASTESWTSGSQRSSRGSDSKDSESLAESYPLSVTDEVEEEEEV
ETVSSSNSRNSGVSLSPSPGERSETSKGSVSAPFHSTSPWKEDKSAASLGTQSSPDECSV
KDSGKGDSEYNDSDSDIGGERMKKISLQMAEKQAGVPVSMERRTFKDPKRSSLIQEYPKS
KNLSSHCDNVYKIAFSSSSIHQHHSQLRNINFHTQDSELKEYYYQVCAPQSERLLSVYER
APNSGTIMPLSTLLRQNNGLNRPTENTLPLHTSEISTSF
Download sequence
Identical sequences F6ZCS7
ENSMODP00000018413 ENSMODP00000018413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]