SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018424 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018424
Domain Number 1 Region: 484-611
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-29
Family Cadherin 0.0025
Further Details:      
 
Domain Number 2 Region: 233-359
Classification Level Classification E-value
Superfamily Cadherin-like 2.83e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 123-248
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-22
Family Cadherin 0.0046
Further Details:      
 
Domain Number 4 Region: 399-488
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000183
Family Cadherin 0.0071
Further Details:      
 
Domain Number 5 Region: 602-709
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000111
Family Cadherin 0.0032
Further Details:      
 
Domain Number 6 Region: 29-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000106
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018424   Gene: ENSMODG00000014739   Transcript: ENSMODT00000018757
Sequence length 1069
Comment pep:novel chromosome:BROADO5:7:164388942:164394731:1 gene:ENSMODG00000014739 transcript:ENSMODT00000018757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPVRQGGNPYLFPLQFFCLCLLLSVALSKTVRYSTFEEDVPGTVIGTLAEDMHMKASGE
MSFRLMKQFNSSLIRVRESDGQLTVGESGIDREQLCRQSPQCILAFDVVSYSQEQFRLVH
VEVEVRDINDHSPHFPRSQIPVEVSESAAVGTRIPLEVAVDEDVGSNALQSLRLAEPHSP
FRVELQTRADGAKCADLVLLQELDRESQATYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVTEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFSFGSRTPPEARRLFRLD
PRSGRLTLAGPVDYERKETYELDVRAQDRGPGPRSATCKVIVRIRDVNDNAPDISITPLA
VATAAVHDPPSSHTAASFAAPVSASSAGSGGSELGVASIIPEGAARESLVALVSTSDRDS
GANGQVRCALYGHEHFRLQPAYAGSYLVVTAAPLDRERIAEYNLTLVAEDRGSPPLRTVR
PYTVRVGDENDNAPLFARPIYEVSVRENNPPGAYLATVAARDPDLGRNGKVTYRLLEAEV
GRGGEAVSTYVSVDPSTGAIYALRSFDYEVLRQLDVRIQASDGGSPQLSSTTLVQVRVLD
QNDHAPVLVHPTPANGSLEVAVPGRTARDTAVARVQARDADEGANGELTFALLQQEPREA
FSISRRSGEIVLTGDLSQDPPGRVFRGLLTISDSGHPPLSTTATVSFVVTAGGVTGSSVP
AASGGPERSRPPGSRLGGTGSLQWDTPLIVIIVLAGSCTLLLAAIITIATTCNRRKKEVR
KGGPRREERTGSASGGPSSPSSPEDRSPGSRANMFDVLAFPTGSSAGKAPFGGSTPESSQ
TVVAATEVSGTESNGGARENTCHYEGQKRLRGAHAEPYGSSPGYGKEPAPPVAIWKGHSF
NTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGHS
DRCWSPSCGRTNTHSSPHPSAQLSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEKV
LHRDYDRTITLLSPPRPGRLPDLQEIGVPLYQSPPARYLPPQSGTNENV
Download sequence
Identical sequences F6ZC33
XP_001362726.1.35504 ENSMODP00000018424 ENSMODP00000018424 13616.ENSMODP00000018424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]