SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018475 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018475
Domain Number 1 Region: 85-430
Classification Level Classification E-value
Superfamily Release factor 4.45e-99
Family Release factor 0.000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018475   Gene: ENSMODG00000014772   Transcript: ENSMODT00000018808
Sequence length 444
Comment pep:novel chromosome:BROADO5:7:164901445:164924357:-1 gene:ENSMODG00000014772 transcript:ENSMODT00000018808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYLSVWNLSINYYQQCNFYHLLPHLFRRIRLNPKQCILKPNWNHIYYSPLHRNWSRSY
CHQDTRMLWKHKGLQKYAEDLTGEYQRLDRLLHHVSVSDGDRRTMSRRHAELAQFTAIYK
EIQESEKAIEDLESMCKSLNEQDEKQLLELAFEEREVIDQKINRLCQELFQSLVPKEKDD
KSDVILEVTSGRTTGGDICQQFTKEIFEMYQSYSCYKGWNFEILNYTTADYGGLHHAAAR
ISGDSVYEYMKYEGGIHRVQRIPEVGLSSRMQRIHTGTMSVIVLPQPDEVDIRVEPKDLR
IDTFRAKGAGGQHVNTTDSAVRIVHIPTGLVVECQQQRSQIQNKDTAFRLLRAKLYQQTI
EKEQSKKQSVRKLQVGTRAQSERIRTYNFTQDRVTDHRISYEARDIKEFLCGGRPLDTLI
QRLLVSANEEAIVEFLDNHFKSSK
Download sequence
Identical sequences F7G763
13616.ENSMODP00000018475 ENSMODP00000018475 ENSMODP00000018475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]