SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018532 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018532
Domain Number 1 Region: 339-596
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.94e-100
Family STAT DNA-binding domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 149-344
Classification Level Classification E-value
Superfamily STAT 7.85e-54
Family STAT 0.00016
Further Details:      
 
Domain Number 3 Region: 13-137
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.18e-39
Family Transcription factor STAT-4 N-domain 0.00046
Further Details:      
 
Domain Number 4 Region: 597-719
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-34
Family SH2 domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018532   Gene: ENSMODG00000014836   Transcript: ENSMODT00000018865
Sequence length 809
Comment pep:novel chromosome:BROADO5:2:194111110:194214386:1 gene:ENSMODG00000014836 transcript:ENSMODT00000018865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQPRGYRRCKVMAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQAWNTIDL
DNPQDSVQAAQLLEGLIQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRC
IRHILYNEQRLVREATNCSSPAGNLADALSQKHLQINQTFEELRLVTQDTENELKKLQQT
QEYFIIQYQESLRNQAQFSQLSQLSPQERLTRETALQQKQVSLEAWLQREAQTLQQYRVE
LAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQ
NRQQIRRAEHLCQQLPIPGPVEEILTELNATITDIISALVTSTFIIEKQPPQVLKTQTKF
AATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQA
TGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVV
IVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKE
NLVFLAQKLFNSSSNNMEDYNNMAISWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPH
WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTT
RDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVMCESATAKAVDGYVKPQIKQVV
PEFAGASADSSGGTATYMDQAPSPAVCSQSHYNMYPQNPDSVLDPDADFDLDDTMDVARH
VEELLRRPMDSQCCSPSLLPFCPGFGCIV
Download sequence
Identical sequences F7D2D3
ENSMODP00000018532 ENSMODP00000018532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]